• Gene id: 890

Gene Summary

• Gene Symbol: CCNA2   Gene   UCSC   Ensembl
• Aliases: CCN1, CCNA
• Gene name: cyclin A2
• Alternate names: cyclin-A2, cyclin-A,
• Gene location: 4q27 (121824000: 121816443)     Exons: 8     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. [provide
• OMIM: 123835

Protein Summary

• Protein general information: P20248  
  • Name: Cyclin A2 (Cyclin A) (Cyclin A)
  • Length: 432  
  • Mass: 48,551
• Sequence:

  MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPL
  KDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDG
  SFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEY
  KLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
  VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPES
  LIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

• Structural information:
  • Interpro: IPR032447  IPR013763  IPR036915  IPR004367  IPR006671  
  • Prosite: PS00292
  • CDD: cd00043
  • PDB: 1E9H 1FIN 1FVV 1GY3 1H1P 1H1Q 1H1R 1H1S 1H24 1H25 1H26 1H27 1H28 1JST 1JSU 1OGU 1OI9 1OIU 1OIY 1OKV 1OKW 1OL1 1OL2 1P5E 1PKD 1QMZ 1URC 1VYW 2BKZ 2BPM 2C4G 2C5N 2C5O 2C5V 2C5X 2C6T 2CCH 2CCI 2CJM 2I40 2IW6 2IW8 2IW9 2UUE 2UZB 2UZD 2UZE 2UZL 2V22 2WEV 2WFY
  • PDBsum: 1E9H 1FIN 1FVV 1GY3 1H1P 1H1Q 1H1R 1H1S 1H24 1H25 1H26 1H27 1H28 1JST 1JSU 1OGU 1OI9 1OIU 1OIY 1OKV 1OKW 1OL1 1OL2 1P5E 1PKD 1QMZ 1URC 1VYW 2BKZ 2BPM 2C4G 2C5N 2C5O 2C5V 2C5X 2C6T 2CCH 2CCI 2CJM 2I40 2IW6 2IW8 2IW9 2UUE 2UZB 2UZD 2UZE 2UZL 2V22 2WEV 2WFY
  • DIP: 638
  • STRING: ENSP00000274026
• Other Databases: GeneCards:  CCNA2  Malacards:  CCNA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0001939	female pronucleus	IEA	cellular component
GO:0001940	male pronucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	TAS	biological process
GO:0007265	Ras protein signal transduction	IEP	biological process
GO:0016032	viral process	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0033762	response to glucagon	IEA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0044320	cellular response to leptin stimulus	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0071314	cellular response to cocaine	IEA	biological process
GO:0071373	cellular response to luteinizing hormone stimulus	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071732	cellular response to nitric oxide	IEA	biological process
GO:0090102	cochlea development	IEA	biological process
GO:1990314	cellular response to insulin-like growth factor stimulus	IEA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0001939	female pronucleus	IEA	cellular component
GO:0001940	male pronucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	TAS	biological process
GO:0007265	Ras protein signal transduction	IEP	biological process
GO:0010389	regulation of G2/M transition of mitotic cell cycle	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0033762	response to glucagon	IEA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0044320	cellular response to leptin stimulus	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0071314	cellular response to cocaine	IEA	biological process
GO:0071373	cellular response to luteinizing hormone stimulus	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0071732	cellular response to nitric oxide	IEA	biological process
GO:0090102	cochlea development	IEA	biological process
GO:1990314	cellular response to insulin-like growth factor stimulus	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0007095	mitotic G2 DNA damage checkpoint	TAS	biological process
GO:0007265	Ras protein signal transduction	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04152	AMPK signaling pathway
hsa04110	Cell cycle
hsa04218	Cellular senescence
hsa04914	Progesterone-mediated oocyte maturation
hsa05203	Viral carcinogenesis
hsa05166	Human T-cell leukemia virus 1 infection
hsa05161	Hepatitis B
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection

Diseases

Associated diseases	References
Cancer (bladder)	GAD: 19692168
Cancer (lung)	GAD: 18676680
Cancer (ovarian)	GAD: 19738611
Cancer (esophageal)	GAD: 20453000
Non obstructive azoospermia	MIK: 21219384
Non obstructive azoospermia	MIK: 21219384
Hypospermatogenesis	MIK: 21219384
Male factor infertility	MIK: 21219384
Hypospermatogenesis	MIK: 21219384
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Chronic renal failure	GAD: 21085059
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Nonobstructive azoospermia	MIK: 21219384
Hypospermatogenesis	MIK: 21219384
Male infertility	MIK: 21219384
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21219384	Nonobstructive azoospermia, hypospermatogenesis, male infertility			63 (48 infertile males (nonobstructive azoospermia), 15 normal subjects)	Male infertility	Cyclin A
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray