• Gene id: 8897

Gene Summary

• Gene Symbol: MTMR3   Gene   UCSC   Ensembl
• Aliases: FYVE-DSP1, ZFYVE10
• Gene name: myotubularin related protein 3
• Alternate names: myotubularin-related protein 3, FYVE (Fab1 YGLO23 Vsp27 EEA1 domain) dual-specificity protein phosphatase, FYVE domain-containing dual specificity protein phosphatase 1, phosphatidylinositol-3,5-bisphosphate 3-phosphatase, phosphatidylinositol-3-phosphate pho,
• Gene location: 22q12.2 (29883168: 30030867)     Exons: 21     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-asso

Protein Summary

• Protein general information: Q13615  
  • Name: Myotubularin related protein 3 (EC 3.1.3.48) (FYVE domain containing dual specificity protein phosphatase 1) (FYVE DSP1) (Phosphatidylinositol 3,5 bisphosphate 3 phosphatase) (EC 3.1.3.95) (Phosphatidylinositol 3 phosphate phosphatase) (EC 3.1.3.64) (Zinc
  • Length: 1198  
  • Mass: 133619
• Sequence:

  MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEFVGRAEDAIIALSNYRLHIKFKESLVNVPLQL
  IESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRPPAKIEDLFSFAYHAWCMEVYASEKEQHGDL
  CRPGEHVTSRFKNEVERMGFDMNNAWRISNINEKYKLCGSYPQELIVPAWITDKELESVSSFRSWKRIPAVIYRH
  QSNGAVIARCGQPEVSWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNTSRDFPNGGDLSDVEFDSSLSNAS
  GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQSLRLLCTQMPDPGNW
  LSALESTKWLHHLSVLLKSALLVVHAVDQDQRPVLVHCSDGWDRTPQIVALAKLLLDPYYRTIEGFQVLVEMEWL
  DFGHKFADRCGHGENSDDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERG
  EKHTQERTCSVWSLLRAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPTTPVDDSCAPYPAPGTSP
  DDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGG
  AELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAAL
  RSHLDMSWPLFSQGISEQQSGLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVLPIPVDAKVGYGTSQS
  CSLLPSQVPFETRGPNVDSSTDMLVEDKVKSVSGPQGHHRSCLVNSGKDRLPQTMEPSPSETSLVERPQVGSVVH
  RTSLGSTLSLTRSPCALPLAECKEGLVCNGAPETENRASEQPPGLSTLQMYPTPNGHCANGEAGRSKDSLSRQLS
  AMSCSSAHLHSRNLHHKWLHSHSGRPSATSSPDQPSRSHLDDDGMSVYTDTIQQRLRQIESGHQQEVETLKKQVQ
  ELKSRLESQYLTSSLHFNGDFGDEVTSIPDSESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHC
  YACDSAFWLASRKHHCRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAATSN

• Structural information:
  • Protein Domains: (155..57-)
    (/note="Myotubularin-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00669"-)
  • Interpro: IPR035888  IPR010569  IPR030564  IPR029021  IPR016130   IPR003595  IPR000306  IPR017455  IPR011011  IPR013083  
  • Prosite: PS51339 PS00383 PS50178
  • CDD: cd13341
  • STRING: ENSP00000384651
• Other Databases: GeneCards:  MTMR3  Malacards:  MTMR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0004438	phosphatidylinositol-3-phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0060304	regulation of phosphatidylinositol dephosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:1904562	phosphatidylinositol 5-phosphate metabolic process	IDA	biological process
GO:2000785	regulation of autophagosome assembly	IMP	biological process
GO:0042149	cellular response to glucose starvation	IMP	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004438	phosphatidylinositol-3-phosphatase activity	IBA	molecular function
GO:0019903	protein phosphatase binding	IBA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IBA	biological process
GO:0010506	regulation of autophagy	IBA	biological process
GO:0052629	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity	IBA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0052629	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004438	phosphatidylinositol-3-phosphatase activity	IEA	molecular function
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0052629	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0004438	phosphatidylinositol-3-phosphatase activity	IDA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0004438	phosphatidylinositol-3-phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0060304	regulation of phosphatidylinositol dephosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:1904562	phosphatidylinositol 5-phosphate metabolic process	IDA	biological process
GO:2000785	regulation of autophagosome assembly	IMP	biological process
GO:0042149	cellular response to glucose starvation	IMP	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004438	phosphatidylinositol-3-phosphatase activity	IBA	molecular function
GO:0019903	protein phosphatase binding	IBA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IBA	biological process
GO:0010506	regulation of autophagy	IBA	biological process
GO:0052629	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity	IBA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0052629	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004438	phosphatidylinositol-3-phosphatase activity	IEA	molecular function
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0052629	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0004438	phosphatidylinositol-3-phosphatase activity	IDA	molecular function
GO:0046856	phosphatidylinositol dephosphorylation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04140	Autophagy - animal
hsa04070	Phosphatidylinositol signaling system
hsa00562	Inositol phosphate metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq