• Gene id: 8894

Gene Summary

• Gene Symbol: EIF2S2   Gene   UCSC   Ensembl
• Aliases: EIF2, EIF2B, EIF2beta, PPP1R67, eIF-2-beta
• Gene name: eukaryotic translation initiation factor 2 subunit beta
• Alternate names: eukaryotic translation initiation factor 2 subunit 2, eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa, protein phosphatase 1, regulatory subunit 67,
• Gene location: 20q11.22 (34112242: 34088308)     Exons: 9     NC_000020.11
• Gene summary(Entrez): Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gam
• OMIM: 603908

Protein Summary

• Protein general information: P20042  
  • Name: Eukaryotic translation initiation factor 2 subunit 2 (Eukaryotic translation initiation factor 2 subunit beta) (eIF 2 beta)
  • Length: 333  
  • Mass: 38388
• Sequence:

  MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNF
  FNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDED
  NKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDI
  CKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFL
  QCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN

• Structural information:
  • Interpro: IPR002735  IPR016189  IPR016190  
  • PDB: 6K71 6K72
  • PDBsum: 6K71 6K72
  • STRING: ENSP00000364119
• Other Databases: GeneCards:  EIF2S2  Malacards:  EIF2S2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005850	eukaryotic translation initiation factor 2 complex	IBA	cellular component
GO:0001732	formation of cytoplasmic translation initiation complex	IBA	biological process
GO:0001731	formation of translation preinitiation complex	IBA	biological process
GO:0031369	translation initiation factor binding	IBA	molecular function
GO:0003743	translation initiation factor activity	IBA	molecular function
GO:0003729	mRNA binding	IBA	molecular function
GO:0005850	eukaryotic translation initiation factor 2 complex	IDA	cellular component
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0006413	translational initiation	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0008135	translation factor activity, RNA binding	TAS	molecular function
GO:0008135	translation factor activity, RNA binding	TAS	molecular function
GO:0005850	eukaryotic translation initiation factor 2 complex	TAS	cellular component
GO:0006413	translational initiation	TAS	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001701	in utero embryonic development	IEA	biological process
GO:0002176	male germ cell proliferation	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	NOT|cellular component
GO:0003743	translation initiation factor activity	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)