• Gene id: 8884

Gene Summary

• Gene Symbol: SLC5A6   Gene   UCSC   Ensembl
• Aliases: SMVT
• Gene name: solute carrier family 5 member 6
• Alternate names: sodium-dependent multivitamin transporter, Na(+)-dependent multivitamin transporter, Na+-dependent multivitamin transporter, solute carrier family 5 (sodium-dependent vitamin transporter), member 6, solute carrier family 5 (sodium/multivitamin and iodide cotr,
• Gene location: 2p23.3 (27212341: 27199586)     Exons: 19     NC_000002.12
• OMIM: 602520

Protein Summary

• Protein general information: Q9Y289  
  • Name: Sodium dependent multivitamin transporter (Na(+) dependent multivitamin transporter) (Solute carrier family 5 member 6)
  • Length: 635  
  • Mass: 68642
• Sequence:

  MSVGVSTSAPLSPTSGTSVGMSTFSIMDYVVFVLLLVLSLAIGLYHACRGWGRHTVGELLMADRKMGCLPVALSL
  LATFQSAVAILGVPSEIYRFGTQYWFLGCCYFLGLLIPAHIFIPVFYRLHLTSAYEYLELRFNKTVRVCGTVTFI
  FQMVIYMGVVLYAPSLALNAVTGFDLWLSVLALGIVCTVYTALGGLKAVIWTDVFQTLVMFLGQLAVIIVGSAKV
  GGLGRVWAVASQHGRISGFELDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSRTEKAAVLSCYAVFPF
  QQVSLCVGCLIGLVMFAYYQEYPMSIQQAQAAPDQFVLYFVMDLLKGLPGLPGLFIACLFSGSLSTISSAFNSLA
  TVTMEDLIRPWFPEFSEARAIMLSRGLAFGYGLLCLGMAYISSQMGPVLQAAISIFGMVGGPLLGLFCLGMFFPC
  ANPPGAVVGLLAGLVMAFWIGIGSIVTSMGSSMPPSPSNGSSFSLPTNLTVATVTTLMPLTTFSKPTGLQRFYSL
  SYLWYSAHNSTTVIVVGLIVSLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKP
  RNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL

• Structural information:
  • Interpro: IPR038377  IPR001734  IPR018212  
  • Prosite: PS00456 PS50283
  • STRING: ENSP00000310208
• Other Databases: GeneCards:  SLC5A6  Malacards:  SLC5A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0015233	pantothenate transmembrane transporter activity	IMP	molecular function
GO:0015225	biotin transmembrane transporter activity	IMP	molecular function
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0150104	transport across blood-brain barrier	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:1905135	biotin import across plasma membrane	IMP	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0009925	basal plasma membrane	ISS	cellular component
GO:0015887	pantothenate transmembrane transport	IMP	biological process
GO:0006814	sodium ion transport	IBA	biological process
GO:0008523	sodium-dependent multivitamin transmembrane transporter activity	IBA	molecular function
GO:0015293	symporter activity	IBA	molecular function
GO:0015878	biotin transport	IBA	biological process
GO:0015887	pantothenate transmembrane transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0008523	sodium-dependent multivitamin transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015939	pantothenate metabolic process	TAS	biological process
GO:0055085	transmembrane transport	TAS	biological process
GO:0006768	biotin metabolic process	TAS	biological process
GO:0012506	vesicle membrane	IEA	cellular component
GO:0031526	brush border membrane	IEA	cellular component
GO:0015887	pantothenate transmembrane transport	IEA	biological process
GO:0015878	biotin transport	IEA	biological process
GO:0008523	sodium-dependent multivitamin transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04977	Vitamin digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881