• Gene id: 8880

Gene Summary

• Gene Symbol: FUBP1   Gene   UCSC   Ensembl
• Aliases: FBP, FUBP, hDH V
• Gene name: far upstream element binding protein 1
• Alternate names: far upstream element-binding protein 1, DNA helicase V, FUSE binding protein 1, epididymis secretory sperm binding protein, far upstream element (FUSE) binding protein 1,
• Gene location: 1p31.1 (77979434: 77944054)     Exons: 24     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a single stranded DNA-binding protein that binds to multiple DNA elements, including the far upstream element (FUSE) located upstream of c-myc. Binding to FUSE occurs on the non-coding strand, and is important to the re
• OMIM: 603444

Protein Summary

• Protein general information: Q96AE4  
  • Name: Far upstream element binding protein 1 (FBP) (FUSE binding protein 1) (DNA helicase V) (hDH V)
  • Length: 644  
  • Mass: 67560
• Sequence:

  MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDA
  KKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCML
  TGTPESVQSAKRLLDQIVEKGRPAPGFHHGDGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDG
  PQNTGADKPLRITGDPYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKK
  IQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGG
  LQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGP
  VNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDP
  AKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAP
  TGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ

• Structural information:
  • Protein Domains: (100..16-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (185..25-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (275..33-)
    (/note="KH-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (-)
  • Interpro: IPR015096  IPR004087  IPR004088  IPR036612  
  • Prosite: PS50084
  • PDB: 1J4W 2KXH 4LIJ
  • PDBsum: 1J4W 2KXH 4LIJ
  • DIP: 47273
  • STRING: ENSP00000359804
• Other Databases: GeneCards:  FUBP1  Malacards:  FUBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0010468	regulation of gene expression	TAS	NOT|biological process
GO:0005634	nucleus	IDA	cellular component
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)