• Gene id: 8878

Gene Summary

• Gene Symbol: SQSTM1   Gene   UCSC   Ensembl
• Aliases: A170, DMRV, FTDALS3, NADGP, OSIL, PDB3, ZIP3, p60, p62, p62B
• Gene name: sequestosome 1
• Alternate names: sequestosome-1, EBI3-associated protein of 60 kDa, EBI3-associated protein p60, EBIAP, autophagy receptor p62, oxidative stress induced like, phosphotyrosine independent ligand for the Lck SH2 domain p62, phosphotyrosine-independent ligand for the Lck SH2 domain,
• Gene location: 5q35.3 (179806392: 179838077)     Exons: 11     NC_000005.10
• Gene summary(Entrez): This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to m
• OMIM: 601530

Protein Summary

• Protein general information: Q13501  
  • Name: Sequestosome 1 (EBI3 associated protein of 60 kDa) (EBIAP) (p60) (Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa) (Ubiquitin binding protein p62)
  • Length: 440  
  • Mass: 47687
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLV
  AFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDL
  CSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESA
  SGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
  EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPT
  GLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL

• Structural information:
  • Protein Domains: (3..10-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (389..43-)
    (/note="UBA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212"-)
  • Interpro: IPR000270  IPR034866  IPR033741  IPR015940  IPR009060   IPR000433  
  • Prosite: PS51745 PS50030 PS01357 PS50135
  • CDD: cd06402 cd14320
  • PDB: 1Q02 2JY7 2JY8 2K0B 2KNV 4MJS 4UF8 4UF9 5YP7 5YP8 5YPA 5YPB 5YPC 5YPE 5YPF 5YPG 5YPH 6JM4 6KHZ 6MJ7
  • PDBsum: 1Q02 2JY7 2JY8 2K0B 2KNV 4MJS 4UF8 4UF9 5YP7 5YP8 5YPA 5YPB 5YPC 5YPE 5YPF 5YPG 5YPH 6JM4 6KHZ 6MJ7
  • DIP: 34443
  • STRING: ENSP00000374455
• Other Databases: GeneCards:  SQSTM1  Malacards:  SQSTM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035255	ionotropic glutamate receptor binding	ISS	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	ISS	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	ISS	biological process
GO:0044754	autolysosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005776	autophagosome	IDA	cellular component
GO:0010821	regulation of mitochondrion organization	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0044753	amphisome	IDA	cellular component
GO:0000423	mitophagy	IGI	biological process
GO:0098780	response to mitochondrial depolarisation	IGI	biological process
GO:0000422	autophagy of mitochondrion	NAS	biological process
GO:0007005	mitochondrion organization	IBA	biological process
GO:0005080	protein kinase C binding	IBA	molecular function
GO:0000423	mitophagy	IBA	biological process
GO:0016235	aggresome	IBA	cellular component
GO:0007032	endosome organization	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0044753	amphisome	IBA	cellular component
GO:0035973	aggrephagy	IBA	biological process
GO:0000932	P-body	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0016605	PML body	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016234	inclusion body	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular function
GO:0007032	endosome organization	IDA	biological process
GO:0031397	negative regulation of protein ubiquitination	IDA	biological process
GO:1905719	protein localization to perinuclear region of cytoplasm	IDA	biological process
GO:0006914	autophagy	IDA	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0005776	autophagosome	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0061912	selective autophagy	IMP	biological process
GO:0016236	macroautophagy	ISS	biological process
GO:0006914	autophagy	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035973	aggrephagy	IPI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	TAS	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0005776	autophagosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016236	macroautophagy	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0043130	ubiquitin binding	TAS	molecular function
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903078	positive regulation of protein localization to plasma membrane	IEA	biological process
GO:1900273	positive regulation of long-term synaptic potentiation	IEA	biological process
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0097225	sperm midpiece	IEA	cellular component
GO:0044754	autolysosome	IEA	cellular component
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0016235	aggresome	IEA	cellular component
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0097413	Lewy body	IEA	cellular component
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0002931	response to ischemia	IEA	biological process
GO:0006914	autophagy	TAS	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0030017	sarcomere	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016236	macroautophagy	IMP	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0043130	ubiquitin binding	IDA	molecular function
GO:0019901	protein kinase binding	IDA	molecular function
GO:0042169	SH2 domain binding	IDA	molecular function
GO:0061635	regulation of protein complex stability	IDA	biological process
GO:0046578	regulation of Ras protein signal transduction	NAS	biological process
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0016197	endosomal transport	TAS	biological process
GO:0008104	protein localization	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04140	Autophagy - animal
hsa04217	Necroptosis
hsa04218	Cellular senescence
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Frontotemporal dementia and amyotrophic lateral sclerosis	KEGG:H02342
Paget disease of bone	KEGG:H00437
Frontotemporal dementia and amyotrophic lateral sclerosis	KEGG:H02342
Paget disease of bone	KEGG:H00437
Paget's disease of bone	PMID:11992264
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R