• Gene id: 8876

Gene Summary

• Gene Symbol: VNN1   Gene   UCSC   Ensembl
• Aliases: HDLCQ8, Tiff66
• Gene name: vanin 1
• Alternate names: pantetheinase, pantetheine hydrolase, vannin 1, vascular non-inflammatory molecule 1,
• Gene location: 6q23.2 (132714054: 132680848)     Exons: 7     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participa

Protein Summary

• Protein general information: O95497  
  • Name: Pantetheinase (EC 3.5.1.92) (Pantetheine hydrolase) (Tiff66) (Vascular non inflammatory molecule 1) (Vanin 1)
  • Length: 513  
  • Mass: 57012
  • Tissue specificity: Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin. {ECO
• Sequence:

  MTTQLPAYVAILLFYVSRASCQDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDILEGAITSAADQGAHII
  VTPEDAIYGWNFNRDSLYPYLEDIPDPEVNWIPCNNRNRFGQTPVQERLSCLAKNNSIYVVANIGDKKPCDTSDP
  QCPPDGRYQYNTDVVFDSQGKLVARYHKQNLFMGENQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAVTLVK
  DFHVDTIVFPTAWMNVLPHLSAVEFHSAWAMGMRVNFLASNIHYPSKKMTGSGIYAPNSSRAFHYDMKTEEGKLL
  LSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPN
  EVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETASTRFEMFSLSGTFGTQYVFPEVLLSENQLAPG
  EFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW

• Structural information:
  • Protein Domains: (39..30-)
    (/note="CN-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00054"-)
  • Interpro: IPR012101  IPR040154  IPR003010  IPR036526  
  • Prosite: PS50263
  • CDD: cd07567
  • PDB: 4CYF 4CYG 4CYY
  • PDBsum: 4CYF 4CYG 4CYY
  • STRING: ENSP00000356905
• Other Databases: GeneCards:  VNN1  Malacards:  VNN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015939	pantothenate metabolic process	IBA	biological process
GO:0017159	pantetheine hydrolase activity	IBA	molecular function
GO:0015939	pantothenate metabolic process	IDA	biological process
GO:0017159	pantetheine hydrolase activity	IDA	molecular function
GO:0006807	nitrogen compound metabolic process	IEA	biological process
GO:0016811	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0017159	pantetheine hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015939	pantothenate metabolic process	TAS	biological process
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0033089	positive regulation of T cell differentiation in thymus	IEA	biological process
GO:0002544	chronic inflammatory response	IEA	biological process
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0002526	acute inflammatory response	IEA	biological process
GO:0017159	pantetheine hydrolase activity	IDA	molecular function
GO:0002544	chronic inflammatory response	ISS	biological process
GO:0098609	cell-cell adhesion	ISS	biological process
GO:0033089	positive regulation of T cell differentiation in thymus	ISS	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0015939	pantothenate metabolic process	IDA	biological process
GO:0002526	acute inflammatory response	ISS	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0006979	response to oxidative stress	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00770	Pantothenate and CoA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881