• Gene id: 8875

Gene Summary

• Gene Symbol: VNN2   Gene   UCSC   Ensembl
• Aliases: FOAP-4, GPI-80
• Gene name: vanin 2
• Alternate names: vascular non-inflammatory molecule 2, Vannin 2, glycosylphosphatidyl inositol-anchored protein GPI-80, pantetheinase,
• Gene location: 6q23.2 (132763488: 132743502)     Exons: 12     NC_000006.12
• Gene summary(Entrez): This gene product is a member of the Vanin family of proteins that share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to particip
• OMIM: 610603

Protein Summary

• Protein general information: O95498  
  • Name: Vascular non inflammatory molecule 2 (Vanin 2) (EC 3.5.1.92) (Glycosylphosphatidyl inositol anchored protein GPI 80) (Protein FOAP 4)
  • Length: 520  
  • Mass: 58503
  • Tissue specificity: Widely expressed with higher expression in spleen and blood. {ECO
• Sequence:

  MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAEQGARI
  IVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRD
  STCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFTCFDIFFYDPGVTLVK
  DFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIYAPNGPKVYHYDMKTELGKLL
  LSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTELFENAGNLTVCQKELCCHLSYRMLQ
  KEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVETASTRFEMFSLSGTFGTEYVFPEVLLTEIH
  LSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML

• Structural information:
  • Protein Domains: (31..30-)
    (/note="CN-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00054"-)
  • Interpro: IPR012101  IPR040154  IPR003010  IPR036526  
  • Prosite: PS50263
  • CDD: cd07567
  • STRING: ENSP00000322276
• Other Databases: GeneCards:  VNN2  Malacards:  VNN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017159	pantetheine hydrolase activity	IBA	molecular function
GO:0015939	pantothenate metabolic process	IBA	biological process
GO:0006807	nitrogen compound metabolic process	IEA	biological process
GO:0016811	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0017159	pantetheine hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015939	pantothenate metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0017159	pantetheine hydrolase activity	IDA	molecular function
GO:0015939	pantothenate metabolic process	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0017159	pantetheine hydrolase activity	IBA	molecular function
GO:0015939	pantothenate metabolic process	IBA	biological process
GO:0006807	nitrogen compound metabolic process	IEA	biological process
GO:0016811	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0017159	pantetheine hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015939	pantothenate metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0017159	pantetheine hydrolase activity	IDA	molecular function
GO:0015939	pantothenate metabolic process	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00770	Pantothenate and CoA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881