About Us

Search Result


Gene id 8870
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol IER3   Gene   UCSC   Ensembl
Aliases DIF-2, DIF2, GLY96, IEX-1, IEX-1L, IEX1, PRG1
Gene name immediate early response 3
Alternate names radiation-inducible immediate-early gene IEX-1, PACAP-responsive gene 1 protein, anti-death protein, differentiation-dependent gene 2 protein, expressed in pancreatic carcinoma, gly96, mouse, homolog of, immediate early protein GLY96, immediate early response 3 ,
Gene location 6p21.33 (30744546: 30743198)     Exons: 2     NC_000006.12
Gene summary(Entrez) This gene functions in the protection of cells from Fas- or tumor necrosis factor type alpha-induced apoptosis. Partially degraded and unspliced transcripts are found after virus infection in vitro, but these transcripts are not found in vivo and do not g
OMIM 300926

Protein Summary

Protein general information P46695  

Name: Radiation inducible immediate early gene IEX 1 (Differentiation dependent gene 2 protein) (Protein DIF 2) (Immediate early protein GLY96) (Immediate early response 3 protein) (PACAP responsive gene 1 protein) (Protein PRG1)

Length: 156  Mass: 16903

Sequence MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQL
PVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQ
QHPAAF
Structural information
Interpro:  IPR024829  
MINT:  
STRING:   ENSP00000259874
Other Databases GeneCards:  IER3  Malacards:  IER3

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:2001020 regulation of response to
DNA damage stimulus
IBA biological process
GO:0005634 nucleus
IBA cellular component
GO:0043066 negative regulation of ap
optotic process
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0006915 apoptotic process
TAS biological process
GO:0009653 anatomical structure morp
hogenesis
TAS biological process
GO:0043066 negative regulation of ap
optotic process
TAS biological process
GO:0005634 nucleus
IDA cellular component
GO:2001020 regulation of response to
DNA damage stimulus
IMP biological process
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0014066 regulation of phosphatidy
linositol 3-kinase signal
ing
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0016020 membrane
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
P06959CCKR signaling map
P06959CCKR signaling map
P06959CCKR signaling map
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Hypospermatogenesis MIK: 28361989
Spermatogenic defects MIK: 31037746
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract