• Gene id: 8863

Gene Summary

• Gene Symbol: PER3   Gene   UCSC   Ensembl
• Aliases: FASPS3, GIG13
• Gene name: period circadian regulator 3
• Alternate names: period circadian protein homolog 3, cell growth-inhibiting gene 13 protein, circadian clock protein PERIOD 3, period circadian clock 3, period circadian protein 3,
• Gene location: 1p36.23 (7784284: 7845180)     Exons: 25     NC_000001.11
• Gene summary(Entrez): This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomoto
• OMIM: 603427

Protein Summary

• Protein general information: P56645  
  • Name: Period circadian protein homolog 3 (hPER3) (Cell growth inhibiting gene 13 protein) (Circadian clock protein PERIOD 3)
  • Length: 1201  
  • Mass: 131888
• Sequence:

  MPRGEAPGPGRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPS
  TLDALNYALRCVHSVQANSEFFQILSQNGAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQ
  AALILNRKKDVLASSHFVDLLAPQDMRVFYAHTARAQLPFWNNWTQRAARYECAPVKPFFCRIRGGEDRKQEKCH
  SPFRIIPYLIHVHHPAQPELESEPCCLTVVEKIHSGYEAPRIPVNKRIFTTTHTPGCVFLEVDEKAVPLLGYLPQ
  DLIGTSILSYLHPEDRSLMVAIHQKVLKYAGHPPFEHSPIRFCTQNGDYIILDSSWSSFVNPWSRKISFIIGRHK
  VRTSPLNEDVFATKIKKMNDNDKDITELQEQIYKLLLQPVHVSVSSGYGSLGSSGSQEQLVSIASSSEASGHRVE
  ETKAEQMTLQQVYASVNKIKNLGQQLYIESMTKSSFKPVTGTRTEPNGGGECKTFTSFHQTLKNNSVYTEPCEDL
  RNDEHSPSYQQINCIDSVIRYLKSYNIPALKRKCISCTNTTSSSSEEDKQNHKADDVQALQAGLQIPAIPKSEMP
  TNGRSIDTGGGAPQILSTAMLSLGSGISQCGYSSTIVHVPPPETARDATLFCEPWTLNMQPAPLTSEEFKHVGLT
  AAVLSAHTQKEEQNYVDKFREKILSSPYSSYLQQESRSKAKYSYFQGDSTSKQTRSAGCRKGKHKRKKLPEPPDS
  SSSNTGSGPRRGAHQNAQPCCPSAASSPHTSSPTFPPAAMVPSQAPYLVPAFPLPAATSPGREYAAPGTAPEGLH
  GLPLSEGLQPYPAFPFPYLDTFMTVFLPDPPVCPLLSPSFLPCPFLGATASSAISPSMSSAMSPTLDPPPSVTSQ
  RREEEKWEAQSEGHPFITSRSSSPLQLNLLQEEMPRPSESPDQMRRNTCPQTEYCVTGNNGSESSPATTGALSTG
  SPPRENPSHPTASALSTGSPPMKNPSHPTASALSTGSPPMKNPSHPTASTLSMGLPPSRTPSHPTATVLSTGSPP
  SESPSRTGSAASGSSDSSIYLTSSVYSSKISQNGQQSQDVQKKETFPNVAEEPIWRMIRQTPERILMTYQVPERV
  KEVVLKEDLEKLESMRQQQPQFSHGQKEELAKVYNWIQSQTVTQEIDIQACVTCENEDSADGAATSCGQVLVEDS
  C

• Structural information:
  • Protein Domains: (121..18-)
    (/note="PAS-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00140-)
    (262..32-)
    (/note="PAS-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00140-)
    (337..38-)
    (/note="PAC"-)
  • Interpro: IPR000014  IPR035965  IPR013655  IPR015524  IPR022728  
  • Prosite: PS50112
  • CDD: cd00130
  • STRING: ENSP00000482093
• Other Databases: GeneCards:  PER3  Malacards:  PER3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001222	transcription corepressor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0009416	response to light stimulus	IBA	biological process
GO:0032922	circadian regulation of gene expression	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0043153	entrainment of circadian clock by photoperiod	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IMP	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IMP	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IMP	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IMP	biological process
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045187	regulation of circadian sleep/wake cycle, sleep	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0019900	kinase binding	IEA	molecular function
GO:0007623	circadian rhythm	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04713	Circadian entrainment
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
Familial advanced sleep phase syndrome	KEGG:H00688
Familial advanced sleep phase syndrome	KEGG:H00688
Advanced sleep phase syndrome	PMID:11306557
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881