• Gene id: 8861

Gene Summary

• Gene Symbol: LDB1   Gene   UCSC   Ensembl
• Aliases: CLIM-2, CLIM2, LDB-1, NLI
• Gene name: LIM domain binding 1
• Alternate names: LIM domain-binding protein 1, LIM domain-binding factor CLIM2, LIM domain-binding factor-1, carboxy terminal LIM domain protein 2, carboxyl-terminal LIM domain-binding protein 2, nuclear LIM interactor,
• Gene location: 10q24.32 (102120367: 102102099)     Exons: 14     NC_000010.11

Protein Summary

• Protein general information: Q86U70  
  • Name: LIM domain binding protein 1 (LDB 1) (Carboxyl terminal LIM domain binding protein 2) (CLIM 2) (LIM domain binding factor CLIM2) (hLdb1) (Nuclear LIM interactor)
  • Length: 411  
  • Mass: 46533
  • Tissue specificity: Expressed in a wide range of adult tissues including brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. {ECO
• Sequence:

  MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELN
  KRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIGRTLIPRYFRSIFEGGATELYYVLKHPKEAF
  HSNFVSLDCDQGSMVTQHGKPMFTQVCVEGRLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQ
  LSKNITRCGLSNSTLNYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTRQQPSKRRKRK
  MSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITRLENTQFDAANGIDDE
  DSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ

• Structural information:
  • Interpro: IPR030167  IPR041363  IPR029005  
  • PDB: 2XJY 2XJZ 2YPA 6TYD
  • PDBsum: 2XJY 2XJZ 2YPA 6TYD
  • DIP: 31826
  • STRING: ENSP00000392466
• Other Databases: GeneCards:  LDB1  Malacards:  LDB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0007399	nervous system development	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030274	LIM domain binding	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0030334	regulation of cell migration	ISS	biological process
GO:0043549	regulation of kinase activity	ISS	biological process
GO:0051893	regulation of focal adhesion assembly	ISS	biological process
GO:0031252	cell leading edge	ISS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030274	LIM domain binding	IEA	molecular function
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:1990907	beta-catenin-TCF complex	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:1902036	regulation of hematopoietic stem cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0034243	regulation of transcription elongation from RNA polymerase II promoter	ISS	biological process
GO:0043973	histone H3-K4 acetylation	ISS	biological process
GO:0046985	positive regulation of hemoglobin biosynthetic process	ISS	biological process
GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030182	neuron differentiation	ISS	biological process
GO:0006351	transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0032991	protein-containing complex	ISS	cellular component
GO:0030274	LIM domain binding	IPI	molecular function
GO:0045647	negative regulation of erythrocyte differentiation	ISS	biological process
GO:0007275	multicellular organism development	NAS	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0030274	LIM domain binding	ISS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001102	RNA polymerase II activating transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0007399	nervous system development	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0030274	LIM domain binding	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0030334	regulation of cell migration	ISS	biological process
GO:0043549	regulation of kinase activity	ISS	biological process
GO:0051893	regulation of focal adhesion assembly	ISS	biological process
GO:0031252	cell leading edge	ISS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030274	LIM domain binding	IEA	molecular function
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:1990907	beta-catenin-TCF complex	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:1902036	regulation of hematopoietic stem cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001102	RNA polymerase II activating transcription factor binding	IPI	molecular function
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0034243	regulation of transcription elongation from RNA polymerase II promoter	ISS	biological process
GO:0043973	histone H3-K4 acetylation	ISS	biological process
GO:0046985	positive regulation of hemoglobin biosynthetic process	ISS	biological process
GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030182	neuron differentiation	ISS	biological process
GO:0006351	transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0032991	protein-containing complex	ISS	cellular component
GO:0030274	LIM domain binding	IPI	molecular function
GO:0045647	negative regulation of erythrocyte differentiation	ISS	biological process
GO:0007275	multicellular organism development	NAS	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0030274	LIM domain binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Low sperm motility	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Low sperm motility			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881