• Gene id: 8858

Gene Summary

• Gene Symbol: PROZ   Gene   UCSC   Ensembl
• Aliases: PZ
• Gene name: protein Z, vitamin K dependent plasma glycoprotein
• Alternate names: vitamin K-dependent protein Z, vitamin K-dependent protein Z precursor variant 1,
• Gene location: 13q34 (113155863: 113172385)     Exons: 12     NC_000013.11
• Gene summary(Entrez): This gene encodes a liver vitamin K-dependent glycoprotein that is synthesized in the liver and secreted into the plasma. The encoded protein plays a role in regulating blood coagulation by complexing with protein Z-dependent protease inhibitor to directl
• OMIM: 123834

Protein Summary

• Protein general information: P22891  
  • Name: Vitamin K dependent protein Z
  • Length: 400  
  • Mass: 44744
  • Tissue specificity: Plasma.
• Sequence:

  MAGCVPLLQGLVLVLALHRVEPSVFLPASKANDVLVRWKRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENE
  VVTDEFWRRYKGGSPCISQPCLHNGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTC
  SCAQGYRLGEDHKQCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVIIRENFVLTTAKCSLLHRN
  ITVKTYFNRTSQDPLMIKITHVHVHMRYDADAGENDLSLLELEWPIQCPGAGLPVCTPEKDFAEHLLIPRTRGLL
  SGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQP
  VGGQAHMVLVTKVSRYSLWFKQIMN

• Structural information:
  • Protein Domains: (41..8-)
    (/note="Gla-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00463-)
    (87..12-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (125..16-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR017857  IPR001881  IPR013032  IPR000742  IPR000152   IPR035972  IPR000294  IPR012224  IPR009003  IPR001254  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS00011 PS50998 PS50240
  • PDB: 3F1S 3H5C
  • PDBsum: 3F1S 3H5C
  • STRING: ENSP00000344458
• Other Databases: GeneCards:  PROZ  Malacards:  PROZ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0007596	blood coagulation	IBA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007599	hemostasis	IEA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007596	blood coagulation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Behcet's disease	PMID:14507116
Brain ischemia	PMID:14671240
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray