• Gene id: 8851

Gene Summary

• Gene Symbol: CDK5R1   Gene   UCSC   Ensembl
• Aliases: CDK5P35, CDK5R, NCK5A, p23, p25, p35, p35nck5a
• Gene name: cyclin dependent kinase 5 regulatory subunit 1
• Alternate names: cyclin-dependent kinase 5 activator 1, CDK5 activator 1, TPKII regulatory subunit, neuronal CDK5 activator, regulatory partner for CDK5 kinase, tau protein kinase II 23kDa subunit,
• Gene location: 17q11.2 (32485027: 32491255)     Exons: 9     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by
• OMIM: 603460

Protein Summary

• Protein general information: Q15078  
  • Name: Cyclin dependent kinase 5 activator 1 (CDK5 activator 1) (Cyclin dependent kinase 5 regulatory subunit 1) (TPKII regulatory subunit) [Cleaved into: Cyclin dependent kinase 5 activator 1, p35 (p35); Cyclin dependent kinase 5 activator 1, p25 (p25) (Tau pro
  • Length: 307  
  • Mass: 34060
  • Tissue specificity: Brain and neuron specific.
• Sequence:

  MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQ
  NNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSE
  LLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAV
  LLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
  LLLGLDR

• Structural information:
  • Interpro: IPR004944  IPR036915  
  • PDB: 1H4L 1UNG 1UNH 1UNL 3O0G
  • PDBsum: 1H4L 1UNG 1UNH 1UNL 3O0G
  • DIP: 24222
  • STRING: ENSP00000318486
• Other Databases: GeneCards:  CDK5R1  Malacards:  CDK5R1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043014	alpha-tubulin binding	ISS	molecular function
GO:0048487	beta-tubulin binding	ISS	molecular function
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	TAS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0031175	neuron projection development	TAS	biological process
GO:0000226	microtubule cytoskeleton organization	TAS	biological process
GO:0031116	positive regulation of microtubule polymerization	ISS	biological process
GO:0016241	regulation of macroautophagy	NAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0048013	ephrin receptor signaling pathway	ISS	biological process
GO:0061001	regulation of dendritic spine morphogenesis	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:0016533	protein kinase 5 complex	IEA	cellular component
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0048511	rhythmic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098693	regulation of synaptic vesicle cycle	IEA	biological process
GO:0046875	ephrin receptor binding	IEA	molecular function
GO:0045296	cadherin binding	IEA	molecular function
GO:0043539	protein serine/threonine kinase activator activity	IEA	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016533	protein kinase 5 complex	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0048013	ephrin receptor signaling pathway	IEA	biological process
GO:0042501	serine phosphorylation of STAT protein	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0021819	layer formation in cerebral cortex	IEA	biological process
GO:0021799	cerebral cortex radially oriented cell migration	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0007158	neuron cell-cell adhesion	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0001764	neuron migration	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IEA	molecular function
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043292	contractile fiber	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0035235	ionotropic glutamate receptor signaling pathway	IEA	biological process
GO:0031594	neuromuscular junction	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030182	neuron differentiation	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0009792	embryo development ending in birth or egg hatching	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0090314	positive regulation of protein targeting to membrane	IEA	biological process
GO:0071158	positive regulation of cell cycle arrest	IEA	biological process
GO:0070507	regulation of microtubule cytoskeleton organization	IEA	biological process
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IEA	molecular function
GO:0061001	regulation of dendritic spine morphogenesis	IEA	biological process
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IEA	biological process
GO:0021722	superior olivary nucleus maturation	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0007413	axonal fasciculation	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0002020	protease binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030295	protein kinase activator activity	TAS	molecular function
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0045296	cadherin binding	ISS	molecular function
GO:0043539	protein serine/threonine kinase activator activity	ISS	molecular function
GO:0031175	neuron projection development	ISS	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0005509	calcium ion binding	ISS	molecular function
GO:0001764	neuron migration	ISS	biological process
GO:0043292	contractile fiber	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0035235	ionotropic glutamate receptor signaling pathway	ISS	biological process
GO:0031594	neuromuscular junction	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0007420	brain development	NAS	biological process
GO:0007420	brain development	ISS	biological process
GO:0007411	axon guidance	ISS	biological process
GO:0007213	G protein-coupled acetylcholine receptor signaling pathway	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0016301	kinase activity	ISS	molecular function
GO:0007158	neuron cell-cell adhesion	ISS	biological process
GO:0045664	regulation of neuron differentiation	NAS	biological process
GO:0043525	positive regulation of neuron apoptotic process	ISS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0030182	neuron differentiation	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0007413	axonal fasciculation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05030	Cocaine addiction

Diseases

Associated diseases	References
Alzheimer's disease	PMID:28578378
Alzheimer's disease	PMID:19154537
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881