• Gene id: 8850

Gene Summary

• Gene Symbol: KAT2B   Gene   UCSC   Ensembl
• Aliases: CAF, P/CAF, PCAF
• Gene name: lysine acetyltransferase 2B
• Alternate names: histone acetyltransferase KAT2B, CREBBP-associated factor, K(lysine) acetyltransferase 2B, histone acetylase PCAF, histone acetyltransferase PCAF, p300/CBP-associated factor, spermidine acetyltransferase KAT2B,
• Gene location: 3p24.3 (20040406: 20154403)     Exons: 19     NC_000003.12
• Gene summary(Entrez): CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vi
• OMIM: 603210

Protein Summary

• Protein general information: Q92831  
  • Name: Histone acetyltransferase KAT2B (EC 2.3.1.48) (Histone acetyltransferase PCAF) (Histone acetylase PCAF) (Lysine acetyltransferase 2B) (P300/CBP associated factor) (P/CAF) (Spermidine acetyltransferase KAT2B) (EC 2.3.1.57)
  • Length: 832  
  • Mass: 93013
  • Tissue specificity: Ubiquitously expressed but most abundant in heart and skeletal muscle. Also expressed in the skin, in keratinocytes (at protein level) (PubMed
• Sequence:

  MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARI
  AVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHL
  ENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGV
  NNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
  YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSR
  TSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIP
  MELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQ
  LPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
  DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIE
  RKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFME
  PVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIK
  EAGLIDK

• Structural information:
  • Protein Domains: (503..65-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000250|UniProtKB:Q92830,-ECO:0000255|PROSITE-ProRule:PRU00532)
    (740..81-)
    (/note="Bromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035,-ECO:0000305")
  • Interpro: IPR016181  IPR001487  IPR036427  IPR018359  IPR037800   IPR016376  IPR000182  IPR009464  
  • Prosite: PS00633 PS50014 PS51186
  • PDB: 1CM0 1JM4 1N72 1WUG 1WUM 1ZS5 2RNW 2RNX 3GG3 4NSQ 5FDZ 5FE0 5FE1 5FE2 5FE3 5FE4 5FE5 5FE6 5FE7 5FE8 5FE9 5LVQ 5LVR 5MKX 6J3O
  • PDBsum: 1CM0 1JM4 1N72 1WUG 1WUM 1ZS5 2RNW 2RNX 3GG3 4NSQ 5FDZ 5FE0 5FE1 5FE2 5FE3 5FE4 5FE5 5FE6 5FE7 5FE8 5FE9 5LVQ 5LVR 5MKX 6J3O
  • DIP: 29778
  • STRING: ENSP00000263754
• Other Databases: GeneCards:  KAT2B  Malacards:  KAT2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004402	histone acetyltransferase activity	IMP	molecular function
GO:0016407	acetyltransferase activity	IDA	molecular function
GO:0006473	protein acetylation	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0018393	internal peptidyl-lysine acetylation	IDA	biological process
GO:0004402	histone acetyltransferase activity	IDA	molecular function
GO:0061733	peptide-lysine-N-acetyltransferase activity	IDA	molecular function
GO:2000233	negative regulation of rRNA processing	IDA	biological process
GO:0046600	negative regulation of centriole replication	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0061733	peptide-lysine-N-acetyltransferase activity	IDA	molecular function
GO:0061733	peptide-lysine-N-acetyltransferase activity	IDA	molecular function
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	molecular function
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003682	chromatin binding	ISS	molecular function
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	ISS	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060173	limb development	ISS	biological process
GO:0007507	heart development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	ISS	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	ISS	molecular function
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006338	chromatin remodeling	TAS	biological process
GO:0006473	protein acetylation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0004145	diamine N-acetyltransferase activity	IEA	molecular function
GO:0004402	histone acetyltransferase activity	EXP	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0007221	positive regulation of transcription of Notch receptor target	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0045747	positive regulation of Notch signaling pathway	TAS	biological process
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045722	positive regulation of gluconeogenesis	IEA	biological process
GO:0042641	actomyosin	IEA	cellular component
GO:0031674	I band	IEA	cellular component
GO:0018393	internal peptidyl-lysine acetylation	IEA	biological process
GO:0004861	cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA	molecular function
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043970	histone H3-K9 acetylation	IEA	biological process
GO:0031672	A band	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0016573	histone acetylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000123	histone acetyltransferase complex	IEA	cellular component
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	molecular function
GO:0004468	lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IDA	molecular function
GO:0005671	Ada2/Gcn5/Ada3 transcription activator complex	IDA	cellular component
GO:0018394	peptidyl-lysine acetylation	IDA	biological process
GO:0018394	peptidyl-lysine acetylation	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IDA	biological process
GO:0010835	regulation of protein ADP-ribosylation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0018076	N-terminal peptidyl-lysine acetylation	IDA	biological process
GO:0006338	chromatin remodeling	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0016407	acetyltransferase activity	IDA	molecular function
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0006473	protein acetylation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0016407	acetyltransferase activity	IDA	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0006338	chromatin remodeling	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003712	transcription coregulator activity	IPI	molecular function
GO:0003712	transcription coregulator activity	IPI	molecular function
GO:0032991	protein-containing complex	IPI	cellular component
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000125	PCAF complex	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa04919	Thyroid hormone signaling pathway
hsa04330	Notch signaling pathway

Diseases

Associated diseases	References
Breast cancer	PMID:22199269
Esophagus squamous cell carcinoma	PMID:19525977
hepatocellular carcinoma	PMID:23643089
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881