• Gene id: 885

Gene Summary

• Gene Symbol: CCK   Gene   UCSC   Ensembl
• Gene name: cholecystokinin
• Alternate names: cholecystokinin, cholecystokinin triacontatriapeptide, prepro-cholecystokinin,
• Gene location: 3p22.1 (42266184: 42257823)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded
• OMIM: 607518

SNPs

rs3197744

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.1937841G>T
NC_000020.10   g.1918487G>T
XM_006723545.4   c.*273G>T
XM_005260670.3   c.*273G>T
XM_005260670.1   c.*273G>T
XM_011529173.2   c.*273G>T
NM_080792.2   c.*273G>T
NM_080792.3   c.*273G>T
NM_001330728.1   c.*273G>T
NM_001040022.1   c.*273G>T
NM_0  

rs2472680

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000003.12   g.119808929T>A
NC_000003.12   g.119808929T>C
NC_000003.12   g.119808929T>G
NC_000003.11   g.119527776T>A
NC_000003.11   g.119527776T>C
NC_000003.11   g.119527776T>G
NG_011856.1   g.33446T>A
NG_011856.1   g.33446T>C
NG_011856.1   g.33446T>G|SEQ=[T/A/C/G]

Protein Summary

• Protein general information: P06307  
  • Name: Cholecystokinin (CCK) [Cleaved into: Cholecystokinin 58 (CCK58); Cholecystokinin 58 desnonopeptide ((1 49) CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33); Cholecystokinin 25 (CCK25); Cholecystokinin 18 (CCK18); Cholecystokinin 12 (CCK12);
  • Length: 115  
  • Mass: 12669
• Sequence:

  MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSG
  RMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

• Structural information:
  • Interpro: IPR015499  IPR001651  IPR013152  
  • Prosite: PS00259
  • STRING: ENSP00000379472
• Other Databases: GeneCards:  CCK  Malacards:  CCK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005184	neuropeptide hormone activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0005179	hormone activity	IBA	molecular function
GO:0007586	digestion	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005179	hormone activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1903999	negative regulation of eating behavior	IEA	biological process
GO:0051901	positive regulation of mitochondrial depolarization	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0043195	terminal bouton	IEA	cellular component
GO:0042755	eating behavior	IEA	biological process
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0031334	positive regulation of protein-containing complex assembly	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0042755	eating behavior	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0001764	neuron migration	IEA	biological process
GO:2000987	positive regulation of behavioral fear response	IEA	biological process
GO:2000986	negative regulation of behavioral fear response	IEA	biological process
GO:1904058	positive regulation of sensory perception of pain	IEA	biological process
GO:0051930	regulation of sensory perception of pain	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0043203	axon hillock	IEA	cellular component
GO:0043194	axon initial segment	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0014049	positive regulation of glutamate secretion	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005179	hormone activity	IEA	molecular function
GO:0001836	release of cytochrome c from mitochondria	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0051428	peptide hormone receptor binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0007409	axonogenesis	ISS	biological process
GO:0042755	eating behavior	ISS	biological process
GO:0005184	neuropeptide hormone activity	ISS	molecular function
GO:0001764	neuron migration	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04972	Pancreatic secretion
hsa04911	Insulin secretion
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
morbid obesity	PMID:17443025
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R