• Gene id: 88455

Gene Summary

• Gene Symbol: ANKRD13A   Gene   UCSC   Ensembl
• Aliases: ANKRD13, NY-REN-25
• Gene name: ankyrin repeat domain 13A
• Alternate names: ankyrin repeat domain-containing protein 13A, NY-REN-25 antigen,
• Gene location: 12q24.11 (19431901: 19436077)     Exons: 4     NC_000022.11
• OMIM: 615123

Protein Summary

• Protein general information: Q8IZ07  
  • Name: Ankyrin repeat domain containing protein 13A (Protein KE03)
  • Length: 590  
  • Mass: 67619
• Sequence:

  MSSACDAGDHYPLHLLVWKNDYRQLEKELQGQNVEAVDPRGRTLLHLAVSLGHLESARVLLRHKADVTKENRQGW
  TVLHEAVSTGDPEMVYTVLQHRDYHNTSMALEGVPELLQKILEAPDFYVQMKWEFTSWVPLVSRICPNDVCRIWK
  SGAKLRVDITLLGFENMSWIRGRRSFIFKGEDNWAELMEVNHDDKVVTTERFDLSQEMERLTLDLMKPKSREVER
  RLTSPVINTSLDTKNIAFERTKSGFWGWRTDKAEVVNGYEAKVYTVNNVNVITKIRTEHLTEEEKKRYKADRNPL
  ESLLGTVEHQFGAQGDLTTECATANNPTAITPDEYFNEEFDLKDRDIGRPKELTIRTQKFKAMLWMCEEFPLSLV
  EQVIPIIDLMARTSAHFARLRDFIKLEFPPGFPVKIEIPLFHVLNARITFGNVNGCSTAEESVSQNVEGTQADSA
  SHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQFAIQQSLLESSRSQELSGPASNGGISQTNTYDAQYE
  RAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEEEAELQQVLQLSLTDK

• Structural information:
  • Protein Domains: (483..50-)
    (/note="UIM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00213-)
    (519..53-)
    (/note="UIM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00213-)
    (549..56-)
    (/note="UIM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00213-)
    (-)
  • Interpro: IPR021832  IPR002110  IPR020683  IPR036770  IPR003903  
  • Prosite: PS50297 PS50088 PS50330
  • STRING: ENSP00000261739
• Other Databases: GeneCards:  ANKRD13A  Malacards:  ANKRD13A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:1905667	negative regulation of protein localization to endosome	IDA	biological process
GO:0140036	ubiquitin-dependent protein binding	IDA	molecular function
GO:0005770	late endosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0002091	negative regulation of receptor internalization	IMP	biological process
GO:0140036	ubiquitin-dependent protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray