• Gene id: 8843

Gene Summary

• Gene Symbol: HCAR3   Gene   UCSC   Ensembl
• Aliases: GPR109B, HCA3, HM74, PUMAG, Puma-g
• Gene name: hydroxycarboxylic acid receptor 3
• Alternate names: hydroxycarboxylic acid receptor 3, G-protein coupled receptor 109B, G-protein coupled receptor HM74, G-protein coupled receptor HM74B, GTP-binding protein, hydroxy-carboxylic acid receptor 3, niacin receptor 2, nicotinic acid receptor 2, putative chemokine recept,
• Gene location: 12q24.31 (122716810: 122714755)     Exons: 1     NC_000012.12
• OMIM: 606039

Protein Summary

• Protein general information: P49019  
  • Name: Hydroxycarboxylic acid receptor 3 (G protein coupled receptor 109B) (G protein coupled receptor HM74) (G protein coupled receptor HM74B) (Niacin receptor 2) (Nicotinic acid receptor 2)
  • Length: 387  
  • Mass: 44478
  • Tissue specificity: Expression largely restricted to adipose tissue and spleen. {ECO
• Sequence:

  MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFL
  LIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCL
  LWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAK
  IKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPS
  FPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEP
  ASLEKQLGCCIE

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR028017  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000436714
• Other Databases: GeneCards:  HCAR3  Malacards:  HCAR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030054	cell junction	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq