• Gene id: 8841

Gene Summary

• Gene Symbol: HDAC3   Gene   UCSC   Ensembl
• Aliases: HD3, KDAC3, RPD3, RPD3-2
• Gene name: histone deacetylase 3
• Alternate names: histone deacetylase 3, SMAP45,
• Gene location: 5q31.3 (141636855: 141620875)     Exons: 15     NC_000005.10
• Gene summary(Entrez): Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene b
• OMIM: 147264

Protein Summary

• Protein general information: O15379  
  • Name: Histone deacetylase 3 (HD3) (EC 3.5.1.98) (RPD3 2) (SMAP45)
  • Length: 428  
  • Mass: 48848
  • Tissue specificity: Widely expressed.
• Sequence:

  MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSP
  TNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDI
  VIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRD
  GIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
  RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSV
  QIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

• Structural information:
  • Interpro: IPR000286  IPR003084  IPR023801  IPR037138  IPR023696  
  • PDB: 4A69
  • PDBsum: 4A69
  • DIP: 24253
  • STRING: ENSP00000302967
• Other Databases: GeneCards:  HDAC3  Malacards:  HDAC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0070932	histone H3 deacetylation	IBA	biological process
GO:0070933	histone H4 deacetylation	IBA	biological process
GO:0000118	histone deacetylase complex	IBA	cellular component
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0042307	positive regulation of protein import into nucleus	IDA	biological process
GO:0006476	protein deacetylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0071498	cellular response to fluid shear stress	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0031398	positive regulation of protein ubiquitination	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0016575	histone deacetylation	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0007623	circadian rhythm	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0010832	negative regulation of myotube differentiation	IMP	NOT|biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0000118	histone deacetylase complex	IDA	cellular component
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0006476	protein deacetylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0008134	transcription factor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0006325	chromatin organization	TAS	biological process
GO:0051225	spindle assembly	IMP	biological process
GO:0046329	negative regulation of JNK cascade	IMP	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	IMP	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0004407	histone deacetylase activity	IMP	molecular function
GO:0004407	histone deacetylase activity	IMP	molecular function
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0000118	histone deacetylase complex	TAS	cellular component
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0070932	histone H3 deacetylation	IBA	biological process
GO:0070933	histone H4 deacetylation	IBA	biological process
GO:0000118	histone deacetylase complex	IBA	cellular component
GO:0004407	histone deacetylase activity	IBA	molecular function
GO:0042307	positive regulation of protein import into nucleus	IDA	biological process
GO:0006476	protein deacetylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0031647	regulation of protein stability	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0071498	cellular response to fluid shear stress	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0031398	positive regulation of protein ubiquitination	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0016575	histone deacetylation	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0007623	circadian rhythm	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0010832	negative regulation of myotube differentiation	IMP	NOT|biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0000118	histone deacetylase complex	IDA	cellular component
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:0017053	transcription repressor complex	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0006476	protein deacetylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0008134	transcription factor binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0006325	chromatin organization	TAS	biological process
GO:0051225	spindle assembly	IMP	biological process
GO:0046329	negative regulation of JNK cascade	IMP	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	IMP	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0004407	histone deacetylase activity	IMP	molecular function
GO:0004407	histone deacetylase activity	IMP	molecular function
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0000118	histone deacetylase complex	TAS	cellular component
GO:0042826	histone deacetylase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Cholestasis of pregnancy	PMID:28697498
Prostate cancer	PMID:18212746
Ovarian cancer	PMID:17387270
Endometrial carcinoma	PMID:18714364
Malignant glioma	PMID:23685192
lung non-small cell carcinoma	PMID:24482232
ovarian carcinoma	PMID:18714364
Pulmonary hypertension	PMID:22711276
colorectal cancer	PMID:23724067
type 1 diabetes mellitus	PMID:22772764
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881