• Gene id: 8840

Gene Summary

• Gene Symbol: CCN4   Gene   UCSC   Ensembl
• Aliases: WISP1, WISP1-OT1, WISP1-UT1, WISP1c, WISP1i, WISP1tc
• Gene name: cellular communication network factor 4
• Alternate names: CCN family member 4, WNT1-inducible-signaling pathway protein 1, WISP1 3'UTR-associated RNA 1, WISP1 overlapping transcript 1 (non-protein coding), WNT1 induced secreted protein 1, WNT1 inducible signaling pathway protein 1,
• Gene location: 8q24.22 (133190906: 133231689)     Exons: 6     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di
• OMIM: 176895

Protein Summary

• Protein general information: O95388  
  • Name: CCN family member 4 (WNT1 inducible signaling pathway protein 1) (WISP 1) (Wnt 1 induced secreted protein)
  • Length: 367  
  • Mass: 40331
  • Tissue specificity: Expressed in heart, kidney, lung, pancreas, placenta, ovary, small intestine and spleen. Isoform 2 is expressed predominantly in scirrhous gastric carcinoma and, weakly in placenta. Overexpression is associated with several cancers inc
• Sequence:

  MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLITDGCEC
  CKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGA
  VGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVEAWHRNCIAYTSPWSP
  CSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPEASMNFTLAGCISTRSYQPKY
  CGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPNDIFADLESYPDFSEIAN

• Structural information:
  • Protein Domains: (40..11-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (121..18-)
    (/note="VWFC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (215..26-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR006207  IPR006208  IPR009030  IPR000867  IPR012395   IPR017891  IPR000884  IPR036383  IPR001007  
  • Prosite: PS01185 PS01225 PS00222 PS51323 PS50092 PS01208 PS50184
  • STRING: ENSP00000250160
• Other Databases: GeneCards:  CCN4  Malacards:  CCN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0060548	negative regulation of cell death	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0007155	cell adhesion	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0050707	regulation of cytokine secretion	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IMP	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014911	positive regulation of smooth muscle cell migration	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090303	positive regulation of wound healing	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0060348	bone development	IEA	biological process
GO:0032331	negative regulation of chondrocyte differentiation	IEA	biological process
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005615	extracellular space	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq