• Gene id: 8839

Gene Summary

• Gene Symbol: CCN5   Gene   UCSC   Ensembl
• Aliases: CT58, CTGF-L, WISP2
• Gene name: cellular communication network factor 5
• Alternate names: CCN family member 5, WNT1-inducible-signaling pathway protein 2, WNT1 inducible signaling pathway protein 2, connective tissue growth factor-like protein, connective tissue growth factor-related protein 58,
• Gene location: 20q13.12 (44714203: 44728040)     Exons: 5     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di
• OMIM: 609297

Protein Summary

• Protein general information: O76076  
  • Name: CCN family member 5 (Connective tissue growth factor like protein) (CTGF L) (Connective tissue growth factor related protein 58) (WNT1 inducible signaling pathway protein 2) (WISP 2)
  • Length: 250  
  • Mass: 26825
  • Tissue specificity: Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.
• Sequence:

  MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQG
  LVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRR
  VEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRL
  ETQRRLCLSRPCPPSRGRSPQNSAF

• Structural information:
  • Protein Domains: (24..9-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (98..16-)
    (/note="VWFC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (194..23-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR009030  IPR000867  IPR017891  IPR000884  IPR036383   IPR001007  
  • Prosite: PS00222 PS51323 PS50092 PS01208 PS50184
  • STRING: ENSP00000361959
• Other Databases: GeneCards:  CCN5  Malacards:  CCN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060548	negative regulation of cell death	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0007155	cell adhesion	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray