• Gene id: 8838

Gene Summary

• Gene Symbol: CCN6   Gene   UCSC   Ensembl
• Aliases: LIBC, PPAC, PPD, WISP-3, WISP3
• Gene name: cellular communication network factor 6
• Alternate names: cellular communication network factor 6, CCN family member 6, WNT1 inducible signaling pathway protein 3, epididymis secretory sperm binding protein,
• Gene location: 6q21 (112052812: 112069685)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di
• OMIM: 603400

Protein Summary

• Protein general information: O95389  
  • Name: Cellular communication network factor 6 (CCN family member 6) (WNT1 inducible signaling pathway protein 3) (WISP 3)
  • Length: 354  
  • Mass: 39293
  • Tissue specificity: Predominant expression in adult kidney and testis and fetal kidney. Weaker expression found in placenta, ovary, prostate and small intestine (PubMed
• Sequence:

  MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGVSLVRDGCGCC
  KICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAI
  GCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGM
  GISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICL
  DKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSELKIL

• Structural information:
  • Protein Domains: (44..11-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653-)
    (208..25-)
    (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (268..34-)
    (/note="CTCK-)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR006207  IPR006208  IPR009030  IPR000867  IPR012395   IPR017891  IPR000884  IPR036383  
  • Prosite: PS01225 PS00222 PS51323 PS50092
  • STRING: ENSP00000357655
• Other Databases: GeneCards:  CCN6  Malacards:  CCN6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060548	negative regulation of cell death	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0007155	cell adhesion	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0051881	regulation of mitochondrial membrane potential	IMP	biological process
GO:1903426	regulation of reactive oxygen species biosynthetic process	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005615	extracellular space	NAS	cellular component

Diseases

Associated diseases	References
Progressive pseudorheumatoid dysplasia	KEGG:H00758
Progressive pseudorheumatoid dysplasia	KEGG:H00758
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881