• Gene id: 8835

Gene Summary

• Gene Symbol: SOCS2   Gene   UCSC   Ensembl
• Aliases: CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
• Gene name: suppressor of cytokine signaling 2
• Alternate names: suppressor of cytokine signaling 2, CIS-2, STAT-induced STAT inhibitor 2, cytokine-inducible SH2 protein 2,
• Gene location: 12q22 (93569848: 93626235)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the suppressor of cytokine signaling (SOCS) family. SOCS family members are cytokine-inducible negative regulators of cytokine receptor signaling via the Janus kinase/signal transducer and activation of transcription pathway
• OMIM: 605117

Protein Summary

• Protein general information: O14508  
  • Name: Suppressor of cytokine signaling 2 (SOCS 2) (Cytokine inducible SH2 protein 2) (CIS 2) (STAT induced STAT inhibitor 2) (SSI 2)
  • Length: 198  
  • Mass: 22172
  • Tissue specificity: High expression in heart, placenta, lung, kidney and prostate.
• Sequence:

  MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDS
  SHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHL
  YLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

• Structural information:
  • Protein Domains: (48..15-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (151..19-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR000980  IPR036860  IPR028410  IPR035862  IPR001496   IPR036036  
  • Prosite: PS50001 PS50225
  • CDD: cd10383
  • PDB: 2C9W 4JGH 5BO4 6I4X 6I5J 6I5N
  • PDBsum: 2C9W 4JGH 5BO4 6I4X 6I5J 6I5N
  • DIP: 29569
  • STRING: ENSP00000481249
• Other Databases: GeneCards:  SOCS2  Malacards:  SOCS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001558	regulation of cell growth	IEA	biological process
GO:0008269	JAK pathway signal transduction adaptor activity	IEA	molecular function
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0005159	insulin-like growth factor receptor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0008269	JAK pathway signal transduction adaptor activity	TAS	molecular function
GO:0007259	receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038111	interleukin-7-mediated signaling pathway	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060749	mammary gland alveolus development	IEA	biological process
GO:0040015	negative regulation of multicellular organism growth	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0040014	regulation of multicellular organism growth	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0005131	growth hormone receptor binding	IEA	molecular function
GO:0032355	response to estradiol	IDA	biological process
GO:0060396	growth hormone receptor signaling pathway	IDA	biological process
GO:0032870	cellular response to hormone stimulus	IDA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	NAS	cellular component
GO:0005131	growth hormone receptor binding	NAS	molecular function
GO:0001558	regulation of cell growth	NAS	biological process
GO:0009966	regulation of signal transduction	NAS	biological process
GO:0005159	insulin-like growth factor receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04630	JAK-STAT signaling pathway
hsa04910	Insulin signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04917	Prolactin signaling pathway
hsa04930	Type II diabetes mellitus

Diseases

Associated diseases	References
Ductal carcinoma in situ	PMID:12888825
Endometrial cancer	PMID:15159323
invasive ductal carcinoma	PMID:12888825
ovarian carcinoma	PMID:15361843
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray