• Gene id: 883

Gene Summary

• Gene Symbol: KYAT1   Gene   UCSC   Ensembl
• Aliases: CCBL1, GTK, KAT1, KATI
• Gene name: kynurenine aminotransferase 1
• Alternate names: kynurenine--oxoglutarate transaminase 1, beta-lysase, kidney, cysteine conjugate beta lyase 1, cysteine conjugate-beta lyase, cytoplasmic, cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase), cysteine-S-conjugate,
• Gene location: 9q34.11 (128882522: 128832941)     Exons: 19     NC_000009.12
• Gene summary(Entrez): This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of t
• OMIM: 618532

Protein Summary

• Protein general information: Q16773  
  • Name: Kynurenine oxoglutarate transaminase 1 (EC 2.6.1.7) (Cysteine S conjugate beta lyase) (EC 4.4.1.13) (Glutamine transaminase K) (GTK) (Glutamine phenylpyruvate transaminase) (EC 2.6.1.64) (Kynurenine aminotransferase 1) (Kynurenine aminotransferase I) (K
  • Length: 422  
  • Mass: 47875
• Sequence:

  MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKI
  LASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQ
  NGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQ
  HISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFR
  QPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKG
  LVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

• Structural information:
  • Interpro: IPR004839  IPR034614  IPR015424  IPR015422  IPR015421  
  • PDB: 1W7L 1W7M 1W7N 3FVS 3FVU 3FVX 4WLH 4WLJ 4WP0
  • PDBsum: 1W7L 1W7M 1W7N 3FVS 3FVU 3FVX 4WLH 4WLJ 4WP0
  • STRING: ENSP00000399415
• Other Databases: GeneCards:  KYAT1  Malacards:  KYAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0016212	kynurenine-oxoglutarate transaminase activity	IBA	molecular function
GO:0070189	kynurenine metabolic process	IDA	biological process
GO:0016212	kynurenine-oxoglutarate transaminase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0009058	biosynthetic process	IEA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0047804	cysteine-S-conjugate beta-lyase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006575	cellular modified amino acid metabolic process	IEA	biological process
GO:0016212	kynurenine-oxoglutarate transaminase activity	IEA	molecular function
GO:0070189	kynurenine metabolic process	IEA	biological process
GO:0070548	L-glutamine aminotransferase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0008483	transaminase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008483	transaminase activity	TAS	molecular function
GO:0006575	cellular modified amino acid metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0047804	cysteine-S-conjugate beta-lyase activity	IEA	molecular function
GO:0016212	kynurenine-oxoglutarate transaminase activity	IEA	molecular function
GO:0047316	glutamine-phenylpyruvate transaminase activity	IEA	molecular function
GO:0047804	cysteine-S-conjugate beta-lyase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006559	L-phenylalanine catabolic process	TAS	biological process
GO:0006569	tryptophan catabolic process	TAS	biological process
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0097053	L-kynurenine catabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05204	Chemical carcinogenesis
hsa00270	Cysteine and methionine metabolism
hsa00380	Tryptophan metabolism
hsa00450	Selenocompound metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881