• Gene id: 8829

Gene Summary

• Gene Symbol: NRP1   Gene   UCSC   Ensembl
• Aliases: BDCA4, CD304, NP1, NRP, VEGF165R
• Gene name: neuropilin 1
• Alternate names: neuropilin-1, transmembrane receptor, vascular endothelial cell growth factor 165 receptor,
• Gene location: 10p11.22 (33334904: 33177490)     Exons: 18     NC_000010.11
• Gene summary(Entrez): This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, mad

Protein Summary

• Protein general information: O14786  
  • Name: Neuropilin 1 (Vascular endothelial cell growth factor 165 receptor) (CD antigen CD304)
  • Length: 923  
  • Mass: 103134
  • Tissue specificity: The expression of isoforms 1 and 2 does not seem to overlap. Isoform 1 is expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly exp
• Sequence:

  MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHF
  DLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQN
  YTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIG
  RYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN
  WSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEG
  NKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSS
  NQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSD
  WKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLV
  DECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSV
  LTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQ
  LVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKID
  ETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYN
  FELVDGVKLKKDKLNTQSTYSEA

• Structural information:
  • Protein Domains: (27..14-)
    (/note="CUB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (147..26-)
    (/note="CUB-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (275..42-)
    C (/note="F5/8-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0008-)
  • Interpro: IPR013320  IPR000859  IPR000421  IPR008979  IPR000998   IPR014648  IPR022579  IPR027146  IPR035914  
  • Prosite: PS01180 PS01285 PS01286 PS50022 PS00740 PS50060
  • CDD: cd00041 cd00057 cd06263
  • PDB: 1KEX 2QQI 2QQM 2QQN 3I97 4DEQ 4RN5 5C7G 5IJR 5IYY 5J1X 5JGI 5JGQ 5JHK 5L73 6FMC 6FMF
  • PDBsum: 1KEX 2QQI 2QQM 2QQN 3I97 4DEQ 4RN5 5C7G 5IJR 5IYY 5J1X 5JGI 5JGQ 5JHK 5L73 6FMC 6FMF
  • DIP: 5743
  • STRING: ENSP00000265371
• Other Databases: GeneCards:  NRP1  Malacards:  NRP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150018	basal dendrite development	ISS	biological process
GO:0150020	basal dendrite arborization	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0097475	motor neuron migration	ISS	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0038084	vascular endothelial growth factor signaling pathway	IEA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0005021	vascular endothelial growth factor-activated receptor activity	IEA	molecular function
GO:0007411	axon guidance	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0017154	semaphorin receptor activity	IEA	molecular function
GO:0019838	growth factor binding	IEA	molecular function
GO:0035767	endothelial cell chemotaxis	IEA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005021	vascular endothelial growth factor-activated receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903375	facioacoustic ganglion development	IEA	biological process
GO:1902378	VEGF-activated neuropilin signaling pathway involved in axon guidance	IEA	biological process
GO:1902336	positive regulation of retinal ganglion cell axon guidance	IEA	biological process
GO:1901998	toxin transport	IEA	biological process
GO:0150020	basal dendrite arborization	IEA	biological process
GO:0150018	basal dendrite development	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0097490	sympathetic neuron projection extension	IEA	biological process
GO:0097475	motor neuron migration	IEA	biological process
GO:0097443	sorting endosome	IEA	cellular component
GO:0097374	sensory neuron axon guidance	IEA	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0071679	commissural neuron axon guidance	IEA	biological process
GO:0061549	sympathetic ganglion development	IEA	biological process
GO:0060666	dichotomous subdivision of terminal units involved in salivary gland branching	IEA	biological process
GO:0060385	axonogenesis involved in innervation	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0048846	axon extension involved in axon guidance	IEA	biological process
GO:0048841	regulation of axon extension involved in axon guidance	IEA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0043542	endothelial cell migration	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0038085	vascular endothelial growth factor binding	IEA	molecular function
GO:0036486	ventral trunk neural crest cell migration	IEA	biological process
GO:0032489	regulation of Cdc42 protein signal transduction	IEA	biological process
GO:0031290	retinal ganglion cell axon guidance	IEA	biological process
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0021649	vestibulocochlear nerve structural organization	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0016358	dendrite development	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0005883	neurofilament	IEA	cellular component
GO:0003148	outflow tract septum morphogenesis	IEA	biological process
GO:0002040	sprouting angiogenesis	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0009611	response to wounding	IEA	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:1905040	otic placode development	IEA	biological process
GO:1904835	dorsal root ganglion morphogenesis	IEA	biological process
GO:1902946	protein localization to early endosome	IEA	biological process
GO:1902287	semaphorin-plexin signaling pathway involved in axon guidance	IEA	biological process
GO:1902285	semaphorin-plexin signaling pathway involved in neuron projection guidance	IEA	biological process
GO:1901166	neural crest cell migration involved in autonomic nervous system development	IEA	biological process
GO:0099173	postsynapse organization	IEA	biological process
GO:0097491	sympathetic neuron projection guidance	IEA	biological process
GO:0090259	regulation of retinal ganglion cell axon guidance	IEA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0061551	trigeminal ganglion development	IEA	biological process
GO:0061441	renal artery morphogenesis	IEA	biological process
GO:0061299	retina vasculature morphogenesis in camera-type eye	IEA	biological process
GO:0060982	coronary artery morphogenesis	IEA	biological process
GO:0060978	angiogenesis involved in coronary vascular morphogenesis	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0048844	artery morphogenesis	IEA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IEA	biological process
GO:0048842	positive regulation of axon extension involved in axon guidance	IEA	biological process
GO:0048666	neuron development	IEA	biological process
GO:0048485	sympathetic nervous system development	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0042327	positive regulation of phosphorylation	IEA	biological process
GO:0038190	VEGF-activated neuropilin signaling pathway	IEA	biological process
GO:0038189	neuropilin signaling pathway	IEA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IEA	biological process
GO:0021828	gonadotrophin-releasing hormone neuronal migration to the hypothalamus	IEA	biological process
GO:0021785	branchiomotor neuron axon guidance	IEA	biological process
GO:0021675	nerve development	IEA	biological process
GO:0021637	trigeminal nerve structural organization	IEA	biological process
GO:0021636	trigeminal nerve morphogenesis	IEA	biological process
GO:0021612	facial nerve structural organization	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019838	growth factor binding	IEA	molecular function
GO:0017154	semaphorin receptor activity	IEA	molecular function
GO:0008045	motor neuron axon guidance	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0007413	axonal fasciculation	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005021	vascular endothelial growth factor-activated receptor activity	IEA	molecular function
GO:0002042	cell migration involved in sprouting angiogenesis	IEA	biological process
GO:0001569	branching involved in blood vessel morphogenesis	IEA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0017154	semaphorin receptor activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0019955	cytokine binding	NAS	molecular function
GO:0038085	vascular endothelial growth factor binding	IPI	molecular function
GO:0005096	GTPase activator activity	IMP	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	ISS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	NAS	molecular function
GO:0015026	coreceptor activity	TAS	molecular function
GO:0017154	semaphorin receptor activity	NAS	molecular function
GO:0019838	growth factor binding	TAS	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IMP	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0001525	angiogenesis	IMP	biological process
GO:0001764	neuron migration	ISS	biological process
GO:0002040	sprouting angiogenesis	ISS	biological process
GO:0010595	positive regulation of endothelial cell migration	TAS	biological process
GO:0030424	axon	ISS	cellular component
GO:0031290	retinal ganglion cell axon guidance	ISS	biological process
GO:0031410	cytoplasmic vesicle	TAS	cellular component
GO:0035729	cellular response to hepatocyte growth factor stimulus	IMP	biological process
GO:0043235	receptor complex	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048012	hepatocyte growth factor receptor signaling pathway	IMP	biological process
GO:0048846	axon extension involved in axon guidance	ISS	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IMP	biological process
GO:0060301	positive regulation of cytokine activity	TAS	biological process
GO:0060385	axonogenesis involved in innervation	ISS	biological process
GO:0060627	regulation of vesicle-mediated transport	TAS	biological process
GO:0061549	sympathetic ganglion development	ISS	biological process
GO:0071679	commissural neuron axon guidance	ISS	biological process
GO:0097102	endothelial tip cell fate specification	ISS	biological process
GO:0097443	sorting endosome	ISS	cellular component
GO:0097490	sympathetic neuron projection extension	ISS	biological process
GO:1902336	positive regulation of retinal ganglion cell axon guidance	ISS	biological process
GO:0042327	positive regulation of phosphorylation	IMP	biological process
GO:0038190	VEGF-activated neuropilin signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042327	positive regulation of phosphorylation	IMP	biological process
GO:0001569	branching involved in blood vessel morphogenesis	ISS	biological process
GO:0001569	branching involved in blood vessel morphogenesis	ISS	biological process
GO:0001938	positive regulation of endothelial cell proliferation	TAS	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0002116	semaphorin receptor complex	NAS	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0007411	axon guidance	NAS	biological process
GO:0014911	positive regulation of smooth muscle cell migration	TAS	biological process
GO:0021675	nerve development	ISS	biological process
GO:0035767	endothelial cell chemotaxis	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	ISS	biological process
GO:0038190	VEGF-activated neuropilin signaling pathway	ISS	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IMP	biological process
GO:0048842	positive regulation of axon extension involved in axon guidance	ISS	biological process
GO:0048844	artery morphogenesis	ISS	biological process
GO:0048844	artery morphogenesis	ISS	biological process
GO:0050918	positive chemotaxis	ISS	biological process
GO:0060978	angiogenesis involved in coronary vascular morphogenesis	ISS	biological process
GO:0061299	retina vasculature morphogenesis in camera-type eye	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0071526	semaphorin-plexin signaling pathway	NAS	biological process
GO:0090259	regulation of retinal ganglion cell axon guidance	ISS	biological process
GO:0097491	sympathetic neuron projection guidance	ISS	biological process
GO:1901166	neural crest cell migration involved in autonomic nervous system development	ISS	biological process
GO:1902285	semaphorin-plexin signaling pathway involved in neuron projection guidance	ISS	biological process
GO:1902946	protein localization to early endosome	ISS	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0032489	regulation of Cdc42 protein signal transduction	IMP	biological process
GO:0051491	positive regulation of filopodium assembly	IMP	biological process
GO:0003148	outflow tract septum morphogenesis	ISS	biological process
GO:0043542	endothelial cell migration	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0051894	positive regulation of focal adhesion assembly	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:2000251	positive regulation of actin cytoskeleton reorganization	IMP	biological process
GO:0038189	neuropilin signaling pathway	IMP	biological process
GO:0038190	VEGF-activated neuropilin signaling pathway	IMP	biological process
GO:0042327	positive regulation of phosphorylation	IMP	biological process
GO:0042327	positive regulation of phosphorylation	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	IMP	biological process
GO:0006930	substrate-dependent cell migration, cell extension	IMP	biological process
GO:0038189	neuropilin signaling pathway	IMP	biological process
GO:0031532	actin cytoskeleton reorganization	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881