• Gene id: 8828

Gene Summary

• Gene Symbol: NRP2   Gene   UCSC   Ensembl
• Aliases: NP2, NPN2, PRO2714, VEGF165R2
• Gene name: neuropilin 2
• Alternate names: neuropilin-2, neuropilin-2a(17), neuropilin-2a(22), neuropilin-2b(0), receptor for VEGF165 and semaphorins class3, vascular endothelial cell growth factor 165 receptor 2,
• Gene location: 2q33.3 (205682499: 205798130)     Exons: 2     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, i
• OMIM: 602070

SNPs

rs2231599

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.86574546A>G
NC_000001.10   g.87040229A>G
NM_012128.4   c.1474A>G
NM_012128.3   c.1474A>G
XM_011541015.2   c.1321A>G
NR_024602.1   n.1409A>G
NR_024602.2   n.1407A>G
NP_036260.2   p.Ser492Gly
XP_011539317.1   p.Ser441Gly|SEQ=[A/G]|GENE=CLCA4
CLCA4  

rs759981524

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.86579956A>C
NC_000001.11   g.86579956A>G
NC_000001.11   g.86579956A>T
NC_000001.10   g.87045639A>C
NC_000001.10   g.87045639A>G
NC_000001.10   g.87045639A>T
NM_012128.4   c.2371A>C
NM_012128.4   c.2371A>G
NM_012128.4   c.2371A>T
NM_012128.3   c.2371A>C
  

rs757773924

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.86578055C>G
NC_000001.11   g.86578055C>T
NC_000001.10   g.87043738C>G
NC_000001.10   g.87043738C>T
NM_012128.4   c.2105C>G
NM_012128.4   c.2105C>T
NM_012128.3   c.2105C>G
NM_012128.3   c.2105C>T
XM_011541015.2   c.1952C>G
XM_011541015.2   c.1952C>T
NR_0  

Protein Summary

• Protein general information: O60462  
  • Name: Neuropilin 2 (Vascular endothelial cell growth factor 165 receptor 2)
  • Length: 931  
  • Mass: 104831
• Sequence:

  MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPH
  FEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCS
  KNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPL
  IGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
  DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVY
  RHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQI
  SASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFK
  VSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
  VETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSP
  NDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQ
  GGEWKHGRIILPSYDMEYQIVFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGY
  EDEIDDEYEVDWSNSSSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
  SCTTLENYNFELYDGLKHKVKMNHQKCCSEA

• Structural information:
  • Protein Domains: (28..14-)
    (/note="CUB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (149..26-)
    (/note="CUB-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (277..42-)
    C (/note="F5/8-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0008-)
  • Interpro: IPR013320  IPR000859  IPR000421  IPR008979  IPR000998   IPR014648  IPR027143  IPR022579  IPR035914  
  • Prosite: PS01180 PS01285 PS01286 PS50022 PS50060
  • CDD: cd00041 cd00057 cd06263
  • PDB: 2QQJ 2QQK 2QQL 2QQO 4QDQ 4QDR 4QDS 5DN2 5DQ0 6GH8
  • PDBsum: 2QQJ 2QQK 2QQL 2QQO 4QDQ 4QDR 4QDS 5DN2 5DQ0 6GH8
  • DIP: 5745
  • STRING: ENSP00000353582
• Other Databases: GeneCards:  NRP2  Malacards:  NRP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEA	biological process
GO:0038084	vascular endothelial growth factor signaling pathway	IEA	biological process
GO:0005021	vascular endothelial growth factor-activated receptor activity	IEA	molecular function
GO:0007411	axon guidance	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0017154	semaphorin receptor activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	TAS	molecular function
GO:0007411	axon guidance	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903375	facioacoustic ganglion development	IEA	biological process
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0097490	sympathetic neuron projection extension	IEA	biological process
GO:0097374	sensory neuron axon guidance	IEA	biological process
GO:0061549	sympathetic ganglion development	IEA	biological process
GO:0048846	axon extension involved in axon guidance	IEA	biological process
GO:0036486	ventral trunk neural crest cell migration	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0021649	vestibulocochlear nerve structural organization	IEA	biological process
GO:0003148	outflow tract septum morphogenesis	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:1904835	dorsal root ganglion morphogenesis	IEA	biological process
GO:1902285	semaphorin-plexin signaling pathway involved in neuron projection guidance	IEA	biological process
GO:1901166	neural crest cell migration involved in autonomic nervous system development	IEA	biological process
GO:0097491	sympathetic neuron projection guidance	IEA	biological process
GO:0061551	trigeminal ganglion development	IEA	biological process
GO:0050919	negative chemotaxis	IEA	biological process
GO:0021828	gonadotrophin-releasing hormone neuronal migration to the hypothalamus	IEA	biological process
GO:0021675	nerve development	IEA	biological process
GO:0021612	facial nerve structural organization	IEA	biological process
GO:0017154	semaphorin receptor activity	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0001755	neural crest cell migration	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0019955	cytokine binding	NAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	NAS	molecular function
GO:0017154	semaphorin receptor activity	NAS	molecular function
GO:0019838	growth factor binding	TAS	molecular function
GO:0010595	positive regulation of endothelial cell migration	TAS	biological process
GO:0048846	axon extension involved in axon guidance	ISS	biological process
GO:0061549	sympathetic ganglion development	ISS	biological process
GO:0097490	sympathetic neuron projection extension	ISS	biological process
GO:0001938	positive regulation of endothelial cell proliferation	TAS	biological process
GO:0002116	semaphorin receptor complex	NAS	cellular component
GO:0007411	axon guidance	NAS	biological process
GO:0021675	nerve development	ISS	biological process
GO:0097491	sympathetic neuron projection guidance	ISS	biological process
GO:1902285	semaphorin-plexin signaling pathway involved in neuron projection guidance	ISS	biological process
GO:0003148	outflow tract septum morphogenesis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0001525	angiogenesis	NAS	biological process
GO:0017154	semaphorin receptor activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0005021	vascular endothelial growth factor-activated receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray