• Gene id: 8826

Gene Summary

• Gene Symbol: IQGAP1   Gene   UCSC   Ensembl
• Aliases: HUMORFA01, SAR1, p195
• Gene name: IQ motif containing GTPase activating protein 1
• Alternate names: ras GTPase-activating-like protein IQGAP1, RasGAP-like with IQ motifs,
• Gene location: 15q26.1 (90388241: 90502238)     Exons: 39     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several sign
• OMIM: 603379

Protein Summary

• Protein general information: P46940  
  • Name: Ras GTPase activating like protein IQGAP1 (p195)
  • Length: 1657  
  • Mass: 189252
  • Tissue specificity: Expressed in the placenta, lung, and kidney. A lower level expression is seen in the heart, liver, skeletal muscle and pancreas.
• Sequence:

  MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNG
  VYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIYDRKNMPRCIY
  CIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAIN
  EAIDRRIPADTFAALKNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNI
  NKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQSGQTDPLQKEELQSGV
  DAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQVYPFAADLYQKELATLQRQSPEHNLTHPEL
  SVAVEMLSSVALINRALESGDVNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACV
  DHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAV
  LWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKK
  LAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLIT
  RLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRY
  RDRLQYFRDHINDIIKIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
  RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKALSKEKREKLEAYQHL
  FYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKSKVDQIQEIVTGNPT
  VIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHE
  EVKTRLDSSIRNMRAVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAI
  VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKFRRFFQTACDVPEL
  QDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIESLIGESSGNLND
  PNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQ
  RRAIRDAKTPDKMKKSKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRK
  AELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLL
  EIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLL
  NKKFYGK

• Structural information:
  • Protein Domains: (44..15-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (679..71-)
    (/note="WW-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (745..77-)
    (/note="IQ-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR001715  IPR036872  IPR000048  IPR027417  IPR000593   IPR023152  IPR001936  IPR008936  IPR001202  
  • Prosite: PS50021 PS50096 PS00509 PS50018 PS01159 PS50020
  • CDD: cd00014 cd00201
  • PDB: 1X0H 2RR8 3FAY 3I6X 5L0O
  • PDBsum: 1X0H 2RR8 3FAY 3I6X 5L0O
  • DIP: 32597
  • STRING: ENSP00000268182
• Other Databases: GeneCards:  IQGAP1  Malacards:  IQGAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001726	ruffle	IDA	cellular component
GO:0060090	molecular adaptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031267	small GTPase binding	IPI	molecular function
GO:0016477	cell migration	IMP	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IMP	biological process
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0048365	Rac GTPase binding	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0017016	Ras GTPase binding	IBA	molecular function
GO:0051015	actin filament binding	IBA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007346	regulation of mitotic cell cycle	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005095	GTPase inhibitor activity	TAS	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0005516	calmodulin binding	TAS	molecular function
GO:0005884	actin filament	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071364	cellular response to epidermal growth factor stimulus	IEA	biological process
GO:0048365	Rac GTPase binding	IEA	molecular function
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1990776	response to angiotensin	IEA	biological process
GO:1900086	positive regulation of peptidyl-tyrosine autophosphorylation	IEA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0030426	growth cone	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0044344	cellular response to fibroblast growth factor stimulus	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0036120	cellular response to platelet-derived growth factor stimulus	IEA	biological process
GO:0035305	negative regulation of dephosphorylation	IEA	biological process
GO:0017048	Rho GTPase binding	IEA	molecular function
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0010761	fibroblast migration	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0001817	regulation of cytokine production	IEA	biological process
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IEA	biological process
GO:1903829	positive regulation of cellular protein localization	IEA	biological process
GO:1900006	positive regulation of dendrite development	IEA	biological process
GO:0051019	mitogen-activated protein kinase binding	IEA	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0007173	epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IMP	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005516	calmodulin binding	IDA	molecular function
GO:0005078	MAP-kinase scaffold activity	IPI	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0045860	positive regulation of protein kinase activity	IMP	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0001726	ruffle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:1990138	neuron projection extension	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0030424	axon	ISS	cellular component
GO:0015630	microtubule cytoskeleton	ISS	colocalizes with
GO:0015629	actin cytoskeleton	ISS	colocalizes with
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072015	glomerular visceral epithelial cell development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0036057	slit diaphragm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa05205	Proteoglycans in cancer
hsa04520	Adherens junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray