• Gene id: 8825

Gene Summary

• Gene Symbol: LIN7A   Gene   UCSC   Ensembl
• Aliases: LIN-7A, LIN7, MALS-1, MALS1, TIP-33, VELI1
• Gene name: lin-7 homolog A, crumbs cell polarity complex component
• Alternate names: protein lin-7 homolog A, mammalian lin-seven protein 1, tax interaction protein 33, vertebrate LIN7 homolog 1,
• Gene location: 12q21.31 (42896977: 43030534)     Exons: 22     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is involved in generating and maintaining the asymmetric distribution of channels and receptors at the cell membrane. The encoded protein also is required for the localization of some specific channels and can be part of a
• OMIM: 603380

Protein Summary

• Protein general information: O14910  
  • Name: Protein lin 7 homolog A (Lin 7A) (hLin 7) (Mammalian lin seven protein 1) (MALS 1) (Tax interaction protein 33) (TIP 33) (Vertebrate lin 7 homolog 1) (Veli 1)
  • Length: 233  
  • Mass: 25997
  • Tissue specificity: Expressed in brain, testis, kidney, placenta and liver. {ECO
• Sequence:

  MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHET
  ITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLK
  RGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQ
  QTQQNHMS

• Structural information:
  • Protein Domains: (25..8-)
    (/note="L27-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00365-)
    (108..19-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR014775  IPR004172  IPR036892  IPR017365  IPR001478   IPR036034  
  • Prosite: PS51022 PS50106
  • STRING: ENSP00000447488
• Other Databases: GeneCards:  LIN7A  Malacards:  LIN7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097016	L27 domain binding	IBA	molecular function
GO:0016323	basolateral plasma membrane	IBA	cellular component
GO:0007269	neurotransmitter secretion	IBA	biological process
GO:0005911	cell-cell junction	IBA	cellular component
GO:1903361	protein localization to basolateral plasma membrane	IBA	biological process
GO:0097025	MPP7-DLG1-LIN7 complex	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0045199	maintenance of epithelial cell apical/basal polarity	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0006887	exocytosis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0048489	synaptic vesicle transport	IEA	biological process
GO:0048839	inner ear development	IEA	biological process
GO:0097016	L27 domain binding	IPI	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881