• Gene id: 8824

Gene Summary

• Gene Symbol: CES2   Gene   UCSC   Ensembl
• Aliases: CE-2, CES2A1, PCE-2, iCE
• Gene name: carboxylesterase 2
• Alternate names: cocaine esterase, carboxylesterase 2 (intestine, liver), intestinal carboxylesterase; liver carboxylesterase-2, methylumbelliferyl-acetate deacetylase 2,
• Gene location: 16q22.1 (66934470: 66945095)     Exons: 12     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bon
• OMIM: 612478

Protein Summary

• Protein general information: O00748  
  • Name: Cocaine esterase (EC 3.1.1.84) (Carboxylesterase 2) (CE 2) (hCE 2) (EC 3.1.1.1) (Methylumbelliferyl acetate deacetylase 2) (EC 3.1.1.56)
  • Length: 559  
  • Mass: 61807
  • Tissue specificity: Preferentially expressed in intestine with moderate expression in liver. Within the intestine, highest expression is found in small intestine with lower expression in colon and rectum. {ECO
• Sequence:

  MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAP
  PEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGA
  LVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIF
  GESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
  LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKM
  LTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRP
  PHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPA
  VGRALKAHRLQFWKKALPQKIQELEEPEERHTEL

• Structural information:
  • Interpro: IPR029058  IPR002018  IPR019826  IPR019819  
  • Prosite: PS00122 PS00941
  • STRING: ENSP00000317842
• Other Databases: GeneCards:  CES2  Malacards:  CES2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0052689	carboxylic ester hydrolase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0009056	catabolic process	TAS	biological process
GO:0052689	carboxylic ester hydrolase activity	TAS	molecular function
GO:0080030	methyl indole-3-acetate esterase activity	IEA	molecular function
GO:0047374	methylumbelliferyl-acetate deacetylase activity	IEA	molecular function
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0052689	carboxylic ester hydrolase activity	IDA	molecular function
GO:0006693	prostaglandin metabolic process	IDA	biological process
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00983	Drug metabolism - other enzymes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881