• Gene id: 8818

Gene Summary

• Gene Symbol: DPM2   Gene   UCSC   Ensembl
• Aliases: CDG1U
• Gene name: dolichyl-phosphate mannosyltransferase subunit 2, regulatory
• Alternate names: dolichol phosphate-mannose biosynthesis regulatory protein, DPM synthase complex subunit, DPM synthase subunit 2, dolichol-phosphate mannose synthase subunit 2, dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit,
• Gene location: 9q34.11 (127937853: 127935098)     Exons: 5     NC_000009.12
• Gene summary(Entrez): Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mann
• OMIM: 300142

Protein Summary

• Protein general information: O94777  
  • Name: Dolichol phosphate mannose biosynthesis regulatory protein (Dolichol phosphate mannose synthase subunit 2) (DPM synthase subunit 2)
  • Length: 84  
  • Mass: 9312
• Sequence:

  MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLK
  TKRVTKKAQ

• Structural information:
  • Interpro: IPR009914  
  • STRING: ENSP00000322181
• Other Databases: GeneCards:  DPM2  Malacards:  DPM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008047	enzyme activator activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0035269	protein O-linked mannosylation	TAS	biological process
GO:0000506	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	TAS	cellular component
GO:0006506	GPI anchor biosynthetic process	IBA	biological process
GO:0019348	dolichol metabolic process	IBA	biological process
GO:0030234	enzyme regulator activity	IBA	molecular function
GO:0033185	dolichol-phosphate-mannose synthase complex	IBA	cellular component
GO:0019348	dolichol metabolic process	IEA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IEA	cellular component
GO:0030234	enzyme regulator activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0000506	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex	IDA	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0016254	preassembly of GPI anchor in ER membrane	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0033185	dolichol-phosphate-mannose synthase complex	IDA	cellular component
GO:0006506	GPI anchor biosynthetic process	IDA	biological process
GO:0031647	regulation of protein stability	IPI	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis
hsa00563	Glycosylphosphatidylinositol

Diseases

Associated diseases	References
Congenital disorders of glycosylation type I	KEGG:H00118
Congenital disorders of glycosylation type I	KEGG:H00118
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881