• Gene id: 8814

Gene Summary

• Gene Symbol: CDKL1   Gene   UCSC   Ensembl
• Aliases: KKIALRE, P42
• Gene name: cyclin dependent kinase like 1
• Alternate names: cyclin-dependent kinase-like 1, cyclin-dependent kinase-like 1 (CDC2-related kinase), protein kinase p42 KKIALRE, serine/threonine protein kinase KKIALRE,
• Gene location: 14q21.3 (50397398: 50326264)     Exons: 14     NC_000014.9
• Gene summary(Entrez): This gene product is a member of a large family of CDC2-related serine/threonine protein kinases that accumulates primarily in the nucleus. [provided by RefSeq, Nov 2018]
• OMIM: 609321

Protein Summary

• Protein general information: Q00532  
  • Name: Cyclin dependent kinase like 1 (EC 2.7.11.22) (Protein kinase p42 KKIALRE) (Serine/threonine protein kinase KKIALRE)
  • Length: 358  
  • Mass: 41803
  • Tissue specificity: Highly expressed in kidney, and to a lower extent in ovary. {ECO
• Sequence:

  MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKR
  RLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFAR
  LLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPR
  HQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKE
  HNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI

• Structural information:
  • Protein Domains: (5..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 4AGU
  • PDBsum: 4AGU
  • STRING: ENSP00000379176
• Other Databases: GeneCards:  CDKL1  Malacards:  CDKL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0035869	ciliary transition zone	ISS	cellular component
GO:1902017	regulation of cilium assembly	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0035869	ciliary transition zone	ISS	cellular component
GO:1902017	regulation of cilium assembly	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881