• Gene id: 8813

Gene Summary

• Gene Symbol: DPM1   Gene   UCSC   Ensembl
• Aliases: CDGIE, MPDS
• Gene name: dolichyl-phosphate mannosyltransferase subunit 1, catalytic
• Alternate names: dolichol-phosphate mannosyltransferase subunit 1, DPM synthase complex, catalytic subunit, DPM synthase subunit 1, MPD synthase subunit 1, dolichol monophosphate mannose synthase, dolichol-phosphate mannose synthase subunit 1, dolichyl-phosphate beta-D-mannosyl,
• Gene location: 20q13.13 (50958563: 50934854)     Exons: 10     NC_000020.11
• Gene summary(Entrez): Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mann

Protein Summary

• Protein general information: O60762  
  • Name: Dolichol phosphate mannosyltransferase subunit 1 (EC 2.4.1.83) (Dolichol phosphate mannose synthase subunit 1) (DPM synthase subunit 1) (Dolichyl phosphate beta D mannosyltransferase subunit 1) (Mannose P dolichol synthase subunit 1) (MPD synthase subunit
  • Length: 260  
  • Mass: 29634
• Sequence:

  MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVA
  EQLEKIYGSDRILLRPREKKLGLGTAYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKG
  NGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIG
  EVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT

• Structural information:
  • Interpro: IPR039528  IPR001173  IPR029044  
  • CDD: cd06442
  • STRING: ENSP00000360644
• Other Databases: GeneCards:  DPM1  Malacards:  DPM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006506	GPI anchor biosynthetic process	IDA	biological process
GO:0004169	dolichyl-phosphate-mannose-protein mannosyltransferase activity	IDA	molecular function
GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0035268	protein mannosylation	IDA	biological process
GO:0035269	protein O-linked mannosylation	IDA	biological process
GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity	IBA	molecular function
GO:0035269	protein O-linked mannosylation	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0006506	GPI anchor biosynthetic process	IBA	biological process
GO:0019348	dolichol metabolic process	IBA	biological process
GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity	IEA	molecular function
GO:0033185	dolichol-phosphate-mannose synthase complex	IDA	cellular component
GO:0019348	dolichol metabolic process	IDA	biological process
GO:0019348	dolichol metabolic process	IDA	biological process
GO:0006506	GPI anchor biosynthetic process	IDA	biological process
GO:0006506	GPI anchor biosynthetic process	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity	IDA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0033185	dolichol-phosphate-mannose synthase complex	IDA	cellular component
GO:0006506	GPI anchor biosynthetic process	IDA	biological process
GO:0004582	dolichyl-phosphate beta-D-mannosyltransferase activity	IDA	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis

Diseases

Associated diseases	References
Congenital disorders of glycosylation type I	KEGG:H00118
Congenital disorders of glycosylation type I	KEGG:H00118
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray