• Gene id: 8812

Gene Summary

• Gene Symbol: CCNK   Gene   UCSC   Ensembl
• Aliases: CPR4, IDDHDF
• Gene name: cyclin K
• Alternate names: cyclin-K,
• Gene location: 14q32.2 (99481408: 99512439)     Exons: 2     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the transcription cyclin family. These cyclins may regulate transcription through their association with and activation of cyclin-dependent kinases (CDK) that phosphorylate the C-terminal domain (CTD) of the
• OMIM: 603544

Protein Summary

• Protein general information: O75909  
  • Name: Cyclin K
  • Length: 580  
  • Mass: 64240
  • Tissue specificity: Widely expressed. Highest levels in testis. {ECO
• Sequence:

  MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGI
  IYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQT
  IKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEW
  TSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS
  QPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIETTHPPLPPAHPPPDRK
  PPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRPPPPPPSSYMTGMSTTSSYMSGEGYQSLQSM
  MKTEGPSYGALPPAYGPPAHLPYHPHVYPPNPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLP
  PTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR

• Structural information:
  • Interpro: IPR013763  IPR036915  IPR004367  IPR006671  
  • CDD: cd00043
  • PDB: 2I53 4CXA 4NST 4UN0 5ACB 5EFQ 6B3E 6CKX
  • PDBsum: 2I53 4CXA 4NST 4UN0 5ACB 5EFQ 6B3E 6CKX
  • DIP: 50081
  • STRING: ENSP00000374529
• Other Databases: GeneCards:  CCNK  Malacards:  CCNK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001165	positive regulation of phosphorylation of RNA polymerase II C-terminal domain serine 2 residues	IMP	biological process
GO:0044828	negative regulation by host of viral genome replication	IDA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0032786	positive regulation of DNA-templated transcription, elongation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0008024	cyclin/CDK positive transcription elongation factor complex	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0008353	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0002945	cyclin K-CDK13 complex	IPI	cellular component
GO:0002944	cyclin K-CDK12 complex	IPI	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq