• Gene id: 8808

Gene Summary

• Gene Symbol: IL1RL2   Gene   UCSC   Ensembl
• Aliases: IL-1Rrp2, IL-36R, IL1R-rp2, IL1RRP2
• Gene name: interleukin 1 receptor like 2
• Alternate names: interleukin-1 receptor-like 2, IL-1 receptor-related protein 2, IL-36 receptor, interleukin-1 receptor-related protein 2,
• Gene location: 2q12.1 (102186972: 102242909)     Exons: 15     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This

Protein Summary

• Protein general information: Q9HB29  
  • Name: Interleukin 1 receptor like 2 (EC 3.2.2.6) (IL 36 receptor) (IL 36R) (Interleukin 1 receptor related protein 2) (IL 1Rrp2) (IL1R rp2)
  • Length: 575  
  • Mass: 65405
  • Tissue specificity: Expressed in synovial fibroblasts and articular chondrocytes. Expressed in keratinocytes and monocyte-derived dendritic cells. Expressed in monocytes and myeloid dendritic cells; at protein level. {ECO
• Sequence:

  MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQ
  DETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHF
  PKSCVLGPIKWYKDCNEIKGERFTVLETRLLVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGS
  VPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
  TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFKIDIVLWYRSAFHSTE
  TIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYKLFIFGRDEFPGQAVANVIDENVKLCRRLIV
  IVVPESLGFGLLKNLSEEQIAVYSALIQDGMKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMK
  TKFWKTVRYHMPPRRCRPFPPVQLLQHTPCYRTAGPELGSRRKKCTLTTG

• Structural information:
  • Protein Domains: (20..11-)
    1 (/note="Ig-like-C2-type)
    (126..21-)
    2 (/note="Ig-like-C2-type)
    (222..31-)
    3 (/note="Ig-like-C2-type)
    (381..53-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR041416  IPR003599   IPR015621  IPR004076  IPR004074  IPR000157  IPR035897  
  • Prosite: PS50835 PS50104
  • STRING: ENSP00000264257
• Other Databases: GeneCards:  IL1RL2  Malacards:  IL1RL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050727	regulation of inflammatory response	IBA	biological process
GO:0004909	interleukin-1, type I, activating receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004908	interleukin-1 receptor activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0004908	interleukin-1 receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0050135	NAD(P)+ nucleosidase activity	IEA	molecular function
GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0070498	interleukin-1-mediated signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881