• Gene id: 8807

Gene Summary

• Gene Symbol: IL18RAP   Gene   UCSC   Ensembl
• Aliases: ACPL, CD218b, CDw218b, IL-18R-beta, IL-18RAcP, IL-18Rbeta, IL-1R-7, IL-1R7, IL-1RAcPL, IL18RB
• Gene name: interleukin 18 receptor accessory protein
• Alternate names: interleukin-18 receptor accessory protein, CD218 antigen-like family member B, IL-18 receptor accessory protein, IL-18 receptor beta, cluster of differentiation w218b, interleukin-1 receptor 7, interleukin-18 receptor beta,
• Gene location: 2q12.1 (102418549: 102452567)     Exons: 15     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is an accessory subunit of the heterodimeric receptor for interleukin 18 (IL18), a proinflammatory cytokine involved in inducing cell-mediated immunity. This protein enhances the IL18-binding activity of the IL18 receptor
• OMIM: 604509

Protein Summary

• Protein general information: O95256  
  • Name: Interleukin 18 receptor accessory protein (IL 18 receptor accessory protein) (IL 18RAcP) (EC 3.2.2.6) (Accessory protein like) (AcPL) (CD218 antigen like family member B) (CDw218b) (IL 1R accessory protein like) (IL 1RAcPL) (Interleukin 1 receptor 7) (IL
  • Length: 599  
  • Mass: 68310
  • Tissue specificity: Detected in adrenal gland, bone marrow, brain, fetal brain, fetal liver, heart, kidney, lung, liver, peripheral blood leukocytes, placenta, prostate, salivary gland, skeletal muscle, spinal cord, testis, thymus, thyroid, trachea and ut
• Sequence:

  MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMG
  SNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCVKMILEVKPQ
  TNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQ
  SDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
  SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVLLYILLGTIGTLVAVL
  AASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSFPSEATSSLSEEHLALSLFPDVLENKYGYSL
  CLLERDVAPGGVYAEDIVSIIKRSRRGIFILSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPH
  LVKKALRVLPTVTWRGLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW

• Structural information:
  • Protein Domains: (149..23-)
    1 (/note="Ig-like-C2-type)
    (251..35-)
    2 (/note="Ig-like-C2-type)
    (406..55-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR041416  IPR003599   IPR015621  IPR000157  IPR035897  
  • Prosite: PS50835 PS50104
  • PDB: 3WO4
  • PDBsum: 3WO4
  • STRING: ENSP00000264260
• Other Databases: GeneCards:  IL18RAP  Malacards:  IL18RAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042008	interleukin-18 receptor activity	IBA	molecular function
GO:0035655	interleukin-18-mediated signaling pathway	IBA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0035655	interleukin-18-mediated signaling pathway	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0042008	interleukin-18 receptor activity	IDA	molecular function
GO:0045092	interleukin-18 receptor complex	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0050135	NAD(P)+ nucleosidase activity	IEA	molecular function
GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0035655	interleukin-18-mediated signaling pathway	TAS	biological process
GO:0071351	cellular response to interleukin-18	IEA	biological process
GO:0042119	neutrophil activation	IEA	biological process
GO:0035655	interleukin-18-mediated signaling pathway	IEA	biological process
GO:0032635	interleukin-6 production	IEA	biological process
GO:0032609	interferon-gamma production	IEA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IEA	biological process
GO:0035744	T-helper 1 cell cytokine production	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0071345	cellular response to cytokine stimulus	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa05321	Inflammatory bowel disease

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray