• Gene id: 8805

Gene Summary

• Gene Symbol: TRIM24   Gene   UCSC   Ensembl
• Aliases: PTC6, RNF82, TF1A, TIF1, TIF1A, TIF1ALPHA, hTIF1
• Gene name: tripartite motif containing 24
• Alternate names: transcription intermediary factor 1-alpha, E3 ubiquitin-protein ligase TRIM24, RING finger protein 82, RING-type E3 ubiquitin transferase TIF1-alpha, TIF1-alpha, transcriptional intermediary factor 1,
• Gene location: 7q33-q34 (88562981: 88627595)     Exons: 20     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bo
• OMIM: 603406

Protein Summary

• Protein general information: O15164  
  • Name: Transcription intermediary factor 1 alpha (TIF1 alpha) (EC 2.3.2.27) (E3 ubiquitin protein ligase TRIM24) (RING finger protein 82) (RING type E3 ubiquitin transferase TIF1 alpha) (Tripartite motif containing protein 24)
  • Length: 1050  
  • Mass: 116831
• Sequence:

  MEVAVEKAVAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCHQNIQSRAPKLLPCLH
  SFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFATQVGVIRCPVCSQECAERHIIDNFFVKDTTE
  VPSSTVEKSNQVCTSCEDNAEANGFCVECVEWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPF
  HKKEQLKLYCETCDKLTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
  NQKQVEQDIKVAIFTLMVEINKKGKALLHQLESLAKDHRMKLMQQQQEVAGLSKQLEHVMHFSKWAVSSGSSTAL
  LYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINLGSLVIEDKESQPQMPKQNPVVEQNSQPPSG
  LSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPK
  PNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
  GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVT
  MTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRP
  QNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPN
  EDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKL
  TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQN
  CAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK

• Structural information:
  • Protein Domains: (932..98-)
    (/note="Bromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035"-)
  • Interpro: IPR003649  IPR001487  IPR036427  IPR018359  IPR019786   IPR000315  IPR011011  IPR001965  IPR019787  IPR001841  IPR017907  
  • Prosite: PS00633 PS50014 PS50119 PS01359 PS50016 PS00518 PS50089
  • CDD: cd00021
  • PDB: 2YYN 3O33 3O34 3O35 3O36 3O37 4YAB 4YAD 4YAT 4YAX 4YBM 4YBS 4YBT 4YC9 4ZQL 5H1T 5H1U 5H1V
  • PDBsum: 2YYN 3O33 3O34 3O35 3O36 3O37 4YAB 4YAD 4YAT 4YAX 4YBM 4YBS 4YBT 4YC9 4ZQL 5H1T 5H1U 5H1V
  • DIP: 52713
  • STRING: ENSP00000340507
• Other Databases: GeneCards:  TRIM24  Malacards:  TRIM24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0035064	methylated histone binding	IDA	NOT|molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0071391	cellular response to estrogen stimulus	IDA	biological process
GO:0034056	estrogen response element binding	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0002039	p53 binding	IPI	molecular function
GO:0031647	regulation of protein stability	IMP	biological process
GO:0030163	protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002039	p53 binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0005726	perichromatin fibrils	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0055074	calcium ion homeostasis	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0070562	regulation of vitamin D receptor signaling pathway	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005719	nuclear euchromatin	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016922	nuclear receptor binding	IEA	molecular function
GO:0030163	protein catabolic process	IEA	biological process
GO:0031647	regulation of protein stability	IEA	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R