• Gene id: 8803

Gene Summary

• Gene Symbol: SUCLA2   Gene   UCSC   Ensembl
• Aliases: A-BETA, A-SCS, LINC00444, MTDPS5, SCS-betaA
• Gene name: succinate-CoA ligase ADP-forming subunit beta
• Alternate names: succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial, ATP-specific succinyl-CoA synthetase subunit beta, ATP-specific succinyl-CoA synthetase, beta subunit, long intergenic non-protein coding RNA 444, mitochondrial succinyl-CoA ligase [ADP-forming],
• Gene location: 13q14.2 (48001272: 47942655)     Exons: 11     NC_000013.11
• Gene summary(Entrez): Succinyl-CoA synthetase (SCS) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an ATP-specific SCS beta subunit that dimeri
• OMIM: 603921

Protein Summary

• Protein general information: Q9P2R7  
  • Name: Succinate CoA ligase [ADP forming] subunit beta, mitochondrial (EC 6.2.1.5) (ATP specific succinyl CoA synthetase subunit beta) (A SCS) (Succinyl CoA synthetase beta A chain) (SCS betaA)
  • Length: 463  
  • Mass: 50317
  • Tissue specificity: Widely expressed. Not expressed in liver and lung. {ECO
• Sequence:

  MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQRNLSLHEYMSMELLQEAGVSVPKGY
  VAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGR
  ICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQK
  MGFPPNIVESAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDER
  DKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVTEAFKLITSDKKVLAILV
  NIFGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLA
  KQAHVDVKFQLPI

• Structural information:
  • Protein Domains: (61..28-)
    (/note="ATP-grasp-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03220"-)
  • Interpro: IPR011761  IPR013650  IPR013815  IPR005811  IPR017866   IPR034723  IPR005809  IPR016102  
  • Prosite: PS50975 PS01217
  • PDB: 6G4Q
  • PDBsum: 6G4Q
  • STRING: ENSP00000367923
• Other Databases: GeneCards:  SUCLA2  Malacards:  SUCLA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042709	succinate-CoA ligase complex	IBA	cellular component
GO:0006104	succinyl-CoA metabolic process	IBA	biological process
GO:0006099	tricarboxylic acid cycle	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IBA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006104	succinyl-CoA metabolic process	TAS	biological process
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006104	succinyl-CoA metabolic process	IEA	biological process
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006105	succinate metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IEA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0006781	succinyl-CoA pathway	NAS	biological process
GO:0004775	succinate-CoA ligase (ADP-forming) activity	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa00640	Propanoate metabolism
hsa00020	Citrate cycle

Diseases

Associated diseases	References
Mitochondrial DNA depletion syndrome	KEGG:H00469
Mitochondrial DNA depletion syndrome	KEGG:H00469
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray