• Gene id: 8802

Gene Summary

• Gene Symbol: SUCLG1   Gene   UCSC   Ensembl
• Aliases: GALPHA, MTDPS9, SUCLA1
• Gene name: succinate-CoA ligase GDP/ADP-forming subunit alpha
• Alternate names: succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial, SCS-alpha, succinate-CoA ligase alpha subunit, succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial, succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial, succinyl-Co,
• Gene location: 2p11.2 (55027130: 55049488)     Exons: 3     NC_000014.9
• Gene summary(Entrez): This gene encodes the alpha subunit of the heterodimeric enzyme succinate coenzyme A ligase. This enzyme is targeted to the mitochondria and catalyzes the conversion of succinyl CoA and ADP or GDP to succinate and ATP or GTP. Mutations in this gene are th
• OMIM: 611224

Protein Summary

• Protein general information: P53597  
  • Name: Succinate CoA ligase [ADP/GDP forming] subunit alpha, mitochondrial (EC 6.2.1.4) (EC 6.2.1.5) (Succinyl CoA synthetase subunit alpha) (SCS alpha)
  • Length: 346  
  • Mass: 36250
• Sequence:

  MTATLAAAADIATMVSGSSGLAAARLLSRSFLLPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQA
  LEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQ
  DMVRVKHKLLRQEKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVG
  IGGDPFNGTDFIDCLEIFLNDSATEGIILIGEIGGNAEENAAEFLKQHNSGPNSKPVVSFIAGLTAPPGRRMGHA
  GAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML

• Structural information:
  • Interpro: IPR017440  IPR033847  IPR003781  IPR005810  IPR005811   IPR036291  IPR016102  
  • Prosite: PS01216 PS00399
  • PDB: 6G4Q
  • PDBsum: 6G4Q
  • STRING: ENSP00000377446
• Other Databases: GeneCards:  SUCLG1  Malacards:  SUCLG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009361	succinate-CoA ligase complex (ADP-forming)	IBA	cellular component
GO:0006099	tricarboxylic acid cycle	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0004776	succinate-CoA ligase (GDP-forming) activity	IBA	molecular function
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IBA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IEA	molecular function
GO:0004776	succinate-CoA ligase (GDP-forming) activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IEA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa00640	Propanoate metabolism
hsa00020	Citrate cycle

Diseases

Associated diseases	References
Mitochondrial DNA depletion syndrome	KEGG:H00469
Mitochondrial DNA depletion syndrome	KEGG:H00469
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray