• Gene id: 8801

Gene Summary

• Gene Symbol: SUCLG2   Gene   UCSC   Ensembl
• Aliases: G-SCS, GBETA, GTPSCS
• Gene name: succinate-CoA ligase GDP-forming subunit beta
• Alternate names: succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial, GTP-specific succinyl-CoA synthetase beta subunit, GTP-specific succinyl-CoA synthetase subunit beta, SCS-betaG, succinate-CoA ligase GDP-forming beta subunit, succinyl-CoA ligase [GDP-forming] s,
• Gene location: 3p14.1 (67654613: 67360459)     Exons: 14     NC_000003.12
• Gene summary(Entrez): This gene encodes a GTP-specific beta subunit of succinyl-CoA synthetase. Succinyl-CoA synthetase catalyzes the reversible reaction involving the formation of succinyl-CoA and succinate. Alternate splicing results in multiple transcript variants. Pseudoge
• OMIM: 603922

Protein Summary

• Protein general information: Q96I99  
  • Name: Succinate CoA ligase [GDP forming] subunit beta, mitochondrial (EC 6.2.1.4) (GTP specific succinyl CoA synthetase subunit beta) (G SCS) (GTPSCS) (Succinyl CoA synthetase beta G chain) (SCS betaG)
  • Length: 432  
  • Mass: 46511
  • Tissue specificity: Mainly expressed in liver, kidney, heart, spleen and skeletal muscle. Also found in intestine and colon, and in low amounts in lung, brain, prostate, testis and ovary. {ECO
• Sequence:

  MASPVAAQAGKLLRALALRPRFLAAGSQAVQLTSRRWLNLQEYQSKKLMSDNGVRVQRFFVADTANEALEAAKRL
  NAKEIVLKAQILAGGRGKGVFNSGLKGGVHLTKDPNVVGQLAKQMIGYNLATKQTPKEGVKVNKVMVAEALDISR
  ETYLAILMDRSCNGPVLVGSPQGGVDIEEVAASNPELIFKEQIDIFEGIKDSQAQRMAENLGFVGPLKSQAADQI
  TKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDLKYIGLD
  GNIACFVNGAGLAMATCDIIFLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANG
  ITKACRELELKVPLVVRLEGTNVQEAQKILNNSGLPITSAIDLEDAAKKAVASVAKK

• Structural information:
  • Protein Domains: (46..27-)
    (/note="ATP-grasp-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03221"-)
  • Interpro: IPR013650  IPR013815  IPR005811  IPR017866  IPR034722   IPR005809  IPR016102  
  • Prosite: PS01217
  • DIP: 53563
  • STRING: ENSP00000419325
• Other Databases: GeneCards:  SUCLG2  Malacards:  SUCLG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006099	tricarboxylic acid cycle	IBA	biological process
GO:0006104	succinyl-CoA metabolic process	IBA	biological process
GO:0042709	succinate-CoA ligase complex	IBA	cellular component
GO:0004776	succinate-CoA ligase (GDP-forming) activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006104	succinyl-CoA metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004776	succinate-CoA ligase (GDP-forming) activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0004776	succinate-CoA ligase (GDP-forming) activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045244	succinate-CoA ligase complex (GDP-forming)	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0019003	GDP binding	IEA	molecular function
GO:0006104	succinyl-CoA metabolic process	IEA	biological process
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0006105	succinate metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0004776	succinate-CoA ligase (GDP-forming) activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0004775	succinate-CoA ligase (ADP-forming) activity	IEA	molecular function
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006104	succinyl-CoA metabolic process	NAS	biological process
GO:0004776	succinate-CoA ligase (GDP-forming) activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa00640	Propanoate metabolism
hsa00020	Citrate cycle

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray