• Gene id: 8799

Gene Summary

• Gene Symbol: PEX11B   Gene   UCSC   Ensembl
• Aliases: PEX11-BETA, PEX14B
• Gene name: peroxisomal biogenesis factor 11 beta
• Alternate names: peroxisomal membrane protein 11B, peroxin-11B, peroxisomal biogenesis factor 11B, protein PEX11 homolog beta,
• Gene location: 1q21.1 (145918923: 145911347)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene facilitates peroxisomal proliferation and interacts with PEX19. The encoded protein is found in the peroxisomal membrane. Several transcript variants, some protein-coding and some not protein-coding, have been found for th
• OMIM: 603867

Protein Summary

• Protein general information: O96011  
  • Name: Peroxisomal membrane protein 11B (Peroxin 11B) (Peroxisomal biogenesis factor 11B) (Protein PEX11 homolog beta) (PEX11 beta)
  • Length: 259  
  • Mass: 28431
• Sequence:

  MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLRLGNSADALESAKRAV
  HLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQES
  SACSRRLKGSGGGVPGGSETGGLGGPGTPGGGLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKL
  GLWRCGPGIVGLCGLVSSILSILTLIYPWLRLKP

• Structural information:
  • Interpro: IPR008733  
  • STRING: ENSP00000358312
• Other Databases: GeneCards:  PEX11B  Malacards:  PEX11B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044375	regulation of peroxisome size	IBA	biological process
GO:0016559	peroxisome fission	IBA	biological process
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0016559	peroxisome fission	IEA	biological process
GO:0005779	integral component of peroxisomal membrane	IEA	cellular component
GO:0007031	peroxisome organization	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0044375	regulation of peroxisome size	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0016559	peroxisome fission	IDA	biological process
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0016559	peroxisome fission	IDA	biological process
GO:0016559	peroxisome fission	IDA	biological process
GO:0007031	peroxisome organization	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0007031	peroxisome organization	ISS	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	ISS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005779	integral component of peroxisomal membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R