• Gene id: 8797

Gene Summary

• Gene Symbol: TNFRSF10A   Gene   UCSC   Ensembl
• Aliases: APO2, CD261, DR4, TRAILR-1, TRAILR1
• Gene name: TNF receptor superfamily member 10a
• Alternate names: tumor necrosis factor receptor superfamily member 10A, TNF-related apoptosis-inducing ligand receptor 1, TRAIL receptor 1, TRAIL-R1, cytotoxic TRAIL receptor, death receptor 4, tumor necrosis factor receptor superfamily member 10a variant 2, tumor necrosis facto,
• Gene location: 8p21.3 (23225101: 23190451)     Exons: 10     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies
• OMIM: 118440

Protein Summary

• Protein general information: O00220  
  • Name: Tumor necrosis factor receptor superfamily member 10A (Death receptor 4) (TNF related apoptosis inducing ligand receptor 1) (TRAIL receptor 1) (TRAIL R1) (CD antigen CD261)
  • Length: 468  
  • Mass: 50089
  • Tissue specificity: Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells.
• Sequence:

  MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRAPG
  PRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTE
  GVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWS
  DIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEIL
  SNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIV
  PFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVD
  SGKFIYLEDGTGSAVSLE

• Structural information:
  • Protein Domains: (365..44-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR001368  IPR020465  IPR034024   IPR034029  
  • Prosite: PS50017 PS00652 PS50050
  • CDD: cd08315 cd10580
  • PDB: 5CIR
  • PDBsum: 5CIR
  • STRING: ENSP00000221132
• Other Databases: GeneCards:  TNFRSF10A  Malacards:  TNFRSF10A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036462	TRAIL-activated apoptotic signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0036462	TRAIL-activated apoptotic signaling pathway	IBA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0036462	TRAIL-activated apoptotic signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0045569	TRAIL binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0005035	death receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	NAS	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045569	TRAIL binding	NAS	molecular function
GO:0007250	activation of NF-kappaB-inducing kinase activity	NAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	NAS	biological process
GO:0038023	signaling receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04217	Necroptosis
hsa05164	Influenza A
hsa04210	Apoptosis
hsa04650	Natural killer cell mediated cytotoxicity
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
mantle cell lymphoma	PMID:15531454
mantle cell lymphoma	PMID:16217763
urinary bladder cancer	PMID:16217763
breast ductal carcinoma	PMID:17011986
cervical cancer	PMID:16271751
renal cell carcinoma	PMID:16865223
renal cell carcinoma	PMID:17184908
head and neck squamous cell carcinoma	PMID:16217763
multiple myeloma	PMID:16531263
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq