• Gene id: 8795

Gene Summary

• Gene Symbol: TNFRSF10B   Gene   UCSC   Ensembl
• Aliases: CD262, DR5, KILLER, KILLER/DR5, TRAIL-R2, TRAILR2, TRICK2, TRICK2A, TRICK2B, TRICKB, ZTNFR9
• Gene name: TNF receptor superfamily member 10b
• Alternate names: tumor necrosis factor receptor superfamily member 10B, Fas-like protein, TNF-related apoptosis-inducing ligand receptor 2, apoptosis inducing protein TRICK2A/2B, apoptosis inducing receptor TRAIL-R2, cytotoxic TRAIL receptor-2, death domain containing receptor ,
• Gene location: 8p21.3 (44625035: 44648470)     Exons: 7     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an a
• OMIM: 603612

Protein Summary

• Protein general information: O14763  
  • Name: Tumor necrosis factor receptor superfamily member 10B (Death receptor 5) (TNF related apoptosis inducing ligand receptor 2) (TRAIL receptor 2) (TRAIL R2) (CD antigen CD262)
  • Length: 440  
  • Mass: 47878
  • Tissue specificity: Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, pros
• Sequence:

  MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQDLAPQQRAAPQQKRSS
  PSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSP
  EMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVL
  IVAVFVCKSLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
  NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEA
  AGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNADSAMS

• Structural information:
  • Protein Domains: (339..42-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR001368  IPR020465  IPR034024   IPR034029  
  • Prosite: PS50017 PS00652 PS50050
  • CDD: cd08315 cd10580
  • PDB: 1D0G 1D4V 1DU3 1ZA3 2H9G 3X3F 4I9X 4N90 4OD2 6NHW 6NHY
  • PDBsum: 1D0G 1D4V 1DU3 1ZA3 2H9G 3X3F 4I9X 4N90 4OD2 6NHW 6NHY
  • DIP: 33566
  • STRING: ENSP00000276431
• Other Databases: GeneCards:  TNFRSF10B  Malacards:  TNFRSF10B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0036462	TRAIL-activated apoptotic signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0045569	TRAIL binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	NAS	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	NAS	biological process
GO:0038023	signaling receptor activity	NAS	molecular function
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0042981	regulation of apoptotic process	NAS	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0045569	TRAIL binding	NAS	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04217	Necroptosis
hsa05164	Influenza A
hsa04210	Apoptosis
hsa04650	Natural killer cell mediated cytotoxicity
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray