• Gene id: 8794

Gene Summary

• Gene Symbol: TNFRSF10C   Gene   UCSC   Ensembl
• Aliases: CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID
• Gene name: TNF receptor superfamily member 10c
• Alternate names: tumor necrosis factor receptor superfamily member 10C, TNF-related apoptosis-inducing ligand receptor 3, antagonist decoy receptor for TRAIL/Apo-2L, cytotoxic TRAIL receptor-3, decoy TRAIL receptor without death domain, decoy receptor 1, lymphocyte inhibitor of,
• Gene location: 8p21.3 (23102920: 23117444)     Exons: 5     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and
• OMIM: 603613

Protein Summary

• Protein general information: O14798  
  • Name: Tumor necrosis factor receptor superfamily member 10C (Antagonist decoy receptor for TRAIL/Apo 2L) (Decoy TRAIL receptor without death domain) (Decoy receptor 1) (DcR1) (Lymphocyte inhibitor of TRAIL) (TNF related apoptosis inducing ligand receptor 3) (TR
  • Length: 259  
  • Mass: 27407
  • Tissue specificity: Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
• Sequence:

  MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDY
  TNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCV
  EEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAE
  ETMITSPGTPASSHYLSCTIVGIIVLIVLLIVFV

• Structural information:
  • Interpro: IPR001368  IPR020465  IPR034024  
  • Prosite: PS00652 PS50050
  • CDD: cd10580
  • DIP: 6242
  • STRING: ENSP00000349324
• Other Databases: GeneCards:  TNFRSF10C  Malacards:  TNFRSF10C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036462	TRAIL-activated apoptotic signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0045569	TRAIL binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881