• Gene id: 8789

Gene Summary

• Gene Symbol: FBP2   Gene   UCSC   Ensembl
• Gene name: fructose-bisphosphatase 2
• Alternate names: fructose-1,6-bisphosphatase isozyme 2, D-fructose-1,6-bisphosphate 1-phosphohydrolase 2, FBPase 2, fructose-1,6-bisphosphatase 2, hexosediphosphatase, muscle FBPase, muscle fructose-bisphosphatase,
• Gene location: 9q22.32 (94593823: 94558719)     Exons: 7     NC_000009.12
• Gene summary(Entrez): This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. [provided by RefSeq, Jul 2008]
• OMIM: 603144

Protein Summary

• Protein general information: O00757  
  • Name: Fructose 1,6 bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D fructose 1,6 bisphosphate 1 phosphohydrolase 2) (Muscle FBPase)
  • Length: 339  
  • Mass: 36743
  • Tissue specificity: Expressed in skeletal muscle (at protein level). {ECO
• Sequence:

  MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLD
  VLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSE
  KDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATT
  EYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT
  QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS

• Structural information:
  • Interpro: IPR000146  IPR033391  IPR028343  IPR020548  
  • Prosite: PS00124
  • CDD: cd00354
  • PDB: 3IFA 3IFC 4HE0 4HE1 4HE2 5ET5 5ET6 5ET7 5ET8 5K54 5K55 5K56 5L0A 5Q0C
  • PDBsum: 3IFA 3IFC 4HE0 4HE1 4HE2 5ET5 5ET6 5ET7 5ET8 5K54 5K55 5K56 5L0A 5Q0C
  • STRING: ENSP00000364486
• Other Databases: GeneCards:  FBP2  Malacards:  FBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005986	sucrose biosynthetic process	IBA	biological process
GO:0006002	fructose 6-phosphate metabolic process	IBA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0006000	fructose metabolic process	IBA	biological process
GO:0006094	gluconeogenesis	IBA	biological process
GO:0042132	fructose 1,6-bisphosphate 1-phosphatase activity	IBA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0042132	fructose 1,6-bisphosphate 1-phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0042578	phosphoric ester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006094	gluconeogenesis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006000	fructose metabolic process	TAS	biological process
GO:0042132	fructose 1,6-bisphosphate 1-phosphatase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042132	fructose 1,6-bisphosphate 1-phosphatase activity	IEA	molecular function
GO:0006094	gluconeogenesis	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0030018	Z disc	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0006094	gluconeogenesis	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04910	Insulin signaling pathway
hsa01200	Carbon metabolism
hsa04152	AMPK signaling pathway
hsa04922	Glucagon signaling pathway
hsa00010	Glycolysis / Gluconeogenesis
hsa00051	Fructose and mannose metabolism
hsa00030	Pentose phosphate pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881