• Gene id: 8787

Gene Summary

• Gene Symbol: RGS9   Gene   UCSC   Ensembl
• Aliases: PERRS, RGS9L
• Gene name: regulator of G protein signaling 9
• Alternate names: regulator of G-protein signaling 9, regulator of G-protein signalling 9,
• Gene location: 17q24.1 (65137369: 65227702)     Exons: 19     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the RGS family of GTPase activating proteins that function in various signaling pathways by accelerating the deactivation of G proteins. This protein is anchored to photoreceptor membranes in retinal cells and deactivates G p
• OMIM: 603398

Protein Summary

• Protein general information: O75916  
  • Name: Regulator of G protein signaling 9 (RGS9)
  • Length: 674  
  • Mass: 76966
  • Tissue specificity: Highly expressed in the caudate and putamen, lower levels found in the hypothalamus and nucleus accumbens and very low levels in cerebellum. Not expressed in globus pallidus or cingulate cortex. Isoform 2 is expressed predominantly in
• Sequence:

  MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMQNQRVLVTSVPHAMTGSDVLQWIVQRLWISSLEAQNLGN
  FIVRYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDTDYAIYLAKRNIKKKGILEEYEKENYNFLNQK
  MNYKWDFVIMQAKEQYRAGKERNKADRYALDCQEKAYWLVHRCPPGMDNVLDYGLDRVTNPNEVKVNQKQTVVAV
  KKEIMYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWA
  FNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDI
  TVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLAKAIEPQETTKKSSTLPFMRRHLRSSPSPVILR
  QLEEEAKAREAANTVDITQPGQHMAPSPHLTVYTGTCMPPSPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSP
  IRVALESSSGLEQKGECSGSMAPRGPSVTESSEASLDTSWPRSRPRAPPKARMALSFSRFLRRGCLASPVFARLS
  PKCPAVSHGRVQPLGDVGQQLPRLKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWESL

• Structural information:
  • Protein Domains: (30..10-)
    (/note="DEP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00066-)
    (219..28-)
    gamma (/note="G-protein)
    (298..41-)
    (/note="RGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR000591  IPR015898  IPR036284  IPR016137  IPR040759   IPR036305  IPR036388  IPR036390  
  • Prosite: PS50186 PS50132
  • CDD: cd00068
  • STRING: ENSP00000262406
• Other Databases: GeneCards:  RGS9  Malacards:  RGS9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0007601	visual perception	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0008277	regulation of G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0006457	protein folding	TAS	biological process
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0001975	response to amphetamine	IEA	biological process
GO:0007212	dopamine receptor signaling pathway	IEA	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:1905912	regulation of calcium ion export across plasma membrane	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:1904783	positive regulation of NMDA glutamate receptor activity	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05030	Cocaine addiction
hsa04744	Phototransduction

Diseases

Associated diseases	References
Bradyopsia	KEGG:H00973
Bradyopsia	KEGG:H00973
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq