• Gene id: 8784

Gene Summary

• Gene Symbol: TNFRSF18   Gene   UCSC   Ensembl
• Aliases: AITR, CD357, ENERGEN, GITR, GITR-D
• Gene name: TNF receptor superfamily member 18
• Alternate names: tumor necrosis factor receptor superfamily member 18, TNF receptor superfamily activation-inducible protein, activation-inducible TNFR family receptor, glucocorticoid-induced TNFR-related protein,
• Gene location: 1p36.33 (1207900: 1203507)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+)
• OMIM: 602034

Protein Summary

• Protein general information: Q9Y5U5  
  • Name: Tumor necrosis factor receptor superfamily member 18 (Activation inducible TNFR family receptor) (Glucocorticoid induced TNFR related protein) (CD antigen CD357)
  • Length: 241  
  • Mass: 26000
  • Tissue specificity: Expressed in lymph node, peripheral blood leukocytes and weakly in spleen.
• Sequence:

  MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCV
  QPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHN
  AVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPPSTEDARSCQFPEEER
  GERSAEEKGRLGDLWV

• Structural information:
  • Interpro: IPR001368  IPR022318  IPR034018  
  • CDD: cd13417
  • DIP: 29883
  • STRING: ENSP00000328207
• Other Databases: GeneCards:  TNFRSF18  Malacards:  TNFRSF18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045785	positive regulation of cell adhesion	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0045589	regulation of regulatory T cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002687	positive regulation of leukocyte migration	IMP	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0045589	regulation of regulatory T cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002687	positive regulation of leukocyte migration	IMP	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IMP	biological process
GO:0045785	positive regulation of cell adhesion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq