• Gene id: 8780

Gene Summary

• Gene Symbol: RIOK3   Gene   UCSC   Ensembl
• Aliases: SUDD
• Gene name: RIO kinase 3
• Alternate names: serine/threonine-protein kinase RIO3, homolog of the Aspergillus nidulans sudD gene product, sudD (suppressor of bimD6, Aspergillus nidulans) homolog, sudD homolog, sudD suppressor of Aspergillus nidulans bimD6 homolog, sudD suppressor of bimD6 homolog, testicu,
• Gene location: 18q11.2 (23452822: 23483139)     Exons: 12     NC_000018.10
• Gene summary(Entrez): This gene was first identified by the similarity of its product to the Aspergillus nidulans SUDD protein. This gene is now recognized as a member of the right open reading frame (RIO) kinase gene family. This gene encodes a serine/threonine kinase that lo
• OMIM: 603579

Protein Summary

• Protein general information: O14730  
  • Name: Serine/threonine protein kinase RIO3 (EC 2.7.11.1) (RIO kinase 3) (sudD homolog)
  • Length: 519  
  • Mass: 59093
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MDLVGVASPEPGTAAAWGPSKCPWAIPQNTISCSLADVMSEQLAKELQLEEEAAVFPEVAVAEGPFITGENIDTS
  SDLMLAQMLQMEYDREYDAQLRREEKKFNGDSKVSISFENYRKVHPYEDSDSSEDEVDWQDTRDDPYRPAKPVPT
  PKKGFIGKGKDITTKHDEVVCGRKNTARMENFAPEFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKE
  HSTAEKAVDPKTRLLMYKMVNSGMLETITGCISTGKESVVFHAYGGSMEDEKEDSKVIPTECAIKVFKTTLNEFK
  NRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLARMQRAGIPCPTVVLLKKHILVMSFIGHDQVPAPKLKEV
  KLNSEEMKEAYYQTLHLMRQLYHECTLVHADLSEYNMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQFF
  QKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE

• Structural information:
  • Protein Domains: (251..51-)
    (/note="Protein-kinase")
  • Interpro: IPR011009  IPR000687  IPR018935  IPR017406  
  • Prosite: PS01245
  • STRING: ENSP00000341874
• Other Databases: GeneCards:  RIOK3  Malacards:  RIOK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0030688	preribosome, small subunit precursor	IBA	cellular component
GO:0030490	maturation of SSU-rRNA	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0007059	chromosome segregation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0031333	negative regulation of protein-containing complex assembly	IDA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0089720	caspase binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0030688	preribosome, small subunit precursor	IDA	cellular component
GO:0030688	preribosome, small subunit precursor	IDA	cellular component
GO:1990786	cellular response to dsDNA	IMP	biological process
GO:0039534	negative regulation of MDA-5 signaling pathway	IMP	biological process
GO:0030490	maturation of SSU-rRNA	IMP	biological process
GO:0032728	positive regulation of interferon-beta production	IMP	biological process
GO:0071359	cellular response to dsRNA	IMP	biological process
GO:0045089	positive regulation of innate immune response	IMP	biological process
GO:0098586	cellular response to virus	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881