• Gene id: 8775

Gene Summary

• Gene Symbol: NAPA   Gene   UCSC   Ensembl
• Aliases: SNAPA
• Gene name: NSF attachment protein alpha
• Alternate names: alpha-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein, alpha, alpha-SNAP,
• Gene location: 19q13.32-q13.33 (47515090: 47487636)     Exons: 12     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the

Protein Summary

• Protein general information: P54920  
  • Name: Alpha soluble NSF attachment protein (SNAP alpha) (N ethylmaleimide sensitive factor attachment protein alpha)
  • Length: 295  
  • Mass: 33233
• Sequence:

  MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSAAGNAFCQAAQLHLQL
  QSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSAD
  YYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAV
  QKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR

• Structural information:
  • Interpro: IPR000744  IPR011990  
  • CDD: cd15832
  • STRING: ENSP00000263354
• Other Databases: GeneCards:  NAPA  Malacards:  NAPA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000149	SNARE binding	ISS	molecular function
GO:0044877	protein-containing complex binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005483	soluble NSF attachment protein activity	IBA	molecular function
GO:0010807	regulation of synaptic vesicle priming	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0005774	vacuolar membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0019905	syntaxin binding	IBA	molecular function
GO:0035494	SNARE complex disassembly	IBA	biological process
GO:0070044	synaptobrevin 2-SNAP-25-syntaxin-1a complex	IBA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006891	intra-Golgi vesicle-mediated transport	TAS	biological process
GO:0061025	membrane fusion	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000149	SNARE binding	IEA	molecular function
GO:0019905	syntaxin binding	IEA	molecular function
GO:0032781	positive regulation of ATPase activity	IEA	biological process
GO:0032984	protein-containing complex disassembly	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0070044	synaptobrevin 2-SNAP-25-syntaxin-1a complex	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0030182	neuron differentiation	IEA	biological process
GO:0035494	SNARE complex disassembly	IEA	biological process
GO:0070044	synaptobrevin 2-SNAP-25-syntaxin-1a complex	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0010807	regulation of synaptic vesicle priming	IEA	biological process
GO:0016082	synaptic vesicle priming	IEA	biological process
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0045176	apical protein localization	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000149	SNARE binding	ISS	molecular function
GO:0044877	protein-containing complex binding	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005483	soluble NSF attachment protein activity	IBA	molecular function
GO:0010807	regulation of synaptic vesicle priming	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0005774	vacuolar membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0019905	syntaxin binding	IBA	molecular function
GO:0035494	SNARE complex disassembly	IBA	biological process
GO:0070044	synaptobrevin 2-SNAP-25-syntaxin-1a complex	IBA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006891	intra-Golgi vesicle-mediated transport	TAS	biological process
GO:0061025	membrane fusion	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000149	SNARE binding	IEA	molecular function
GO:0019905	syntaxin binding	IEA	molecular function
GO:0032781	positive regulation of ATPase activity	IEA	biological process
GO:0032984	protein-containing complex disassembly	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0070044	synaptobrevin 2-SNAP-25-syntaxin-1a complex	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0019905	syntaxin binding	IEA	molecular function
GO:0030182	neuron differentiation	IEA	biological process
GO:0035494	SNARE complex disassembly	IEA	biological process
GO:0070044	synaptobrevin 2-SNAP-25-syntaxin-1a complex	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0010807	regulation of synaptic vesicle priming	IEA	biological process
GO:0016082	synaptic vesicle priming	IEA	biological process
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0045176	apical protein localization	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04721	Synaptic vesicle cycle

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq