• Gene id: 8774

Gene Summary

• Gene Symbol: NAPG   Gene   UCSC   Ensembl
• Aliases: GAMMASNAP
• Gene name: NSF attachment protein gamma
• Alternate names: gamma-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein, gamma, SNAP-gamma, soluble NSF attachment protein,
• Gene location: 18p11.22 (10526026: 10552768)     Exons: 15     NC_000018.10
• Gene summary(Entrez): This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular mem
• OMIM: 610151

Protein Summary

• Protein general information: Q99747  
  • Name: Gamma soluble NSF attachment protein (SNAP gamma) (N ethylmaleimide sensitive factor attachment protein gamma)
  • Length: 312  
  • Mass: 34746
• Sequence:

  MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAA
  KAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERL
  RQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPG
  FNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAA
  DEEEDEYSGGLC

• Structural information:
  • Interpro: IPR000744  IPR011990  
  • CDD: cd15832
  • STRING: ENSP00000324628
• Other Databases: GeneCards:  NAPG  Malacards:  NAPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031201	SNARE complex	IBA	cellular component
GO:0005483	soluble NSF attachment protein activity	IBA	molecular function
GO:0019905	syntaxin binding	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005774	vacuolar membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006891	intra-Golgi vesicle-mediated transport	TAS	biological process
GO:0061025	membrane fusion	TAS	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0065003	protein-containing complex assembly	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050821	protein stabilization	NAS	biological process
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray