• Gene id: 8773

Gene Summary

• Gene Symbol: SNAP23   Gene   UCSC   Ensembl
• Aliases: HsT17016, SNAP-23, SNAP23A, SNAP23B
• Gene name: synaptosome associated protein 23
• Alternate names: synaptosomal-associated protein 23, synaptosomal-associated protein, 23kD, synaptosomal-associated protein, 23kDa, synaptosome associated protein 23kDa, vesicle-membrane fusion protein SNAP-23,
• Gene location: 15q15.1-q15.2 (42491243: 42533060)     Exons: 11     NC_000015.10
• Gene summary(Entrez): Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-a
• OMIM: 602534

Protein Summary

• Protein general information: O00161  
  • Name: Synaptosomal associated protein 23 (SNAP 23) (Vesicle membrane fusion protein SNAP 23)
  • Length: 211  
  • Mass: 23354
  • Tissue specificity: Ubiquitous. Highest levels where found in placenta.
• Sequence:

  MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTE
  LNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYIKRITNDARED
  EMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLIDS

• Structural information:
  • Protein Domains: (14..7-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202-)
    (146..20-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR000928  IPR000727  
  • Prosite: PS50192
  • PDB: 1NHL 3ZUS
  • PDBsum: 1NHL 3ZUS
  • STRING: ENSP00000249647
• Other Databases: GeneCards:  SNAP23  Malacards:  SNAP23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0016082	synaptic vesicle priming	IBA	biological process
GO:0006906	vesicle fusion	IBA	biological process
GO:0031629	synaptic vesicle fusion to presynaptic active zone membrane	IBA	biological process
GO:0019905	syntaxin binding	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0006903	vesicle targeting	TAS	biological process
GO:0061025	membrane fusion	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006892	post-Golgi vesicle-mediated transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006892	post-Golgi vesicle-mediated transport	TAS	biological process
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005912	adherens junction	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0031201	SNARE complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0042582	azurophil granule	IDA	cellular component
GO:0042581	specific granule	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0019905	syntaxin binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0002553	histamine secretion by mast cell	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04611	Platelet activation
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray