• Gene id: 8772

Gene Summary

• Gene Symbol: FADD   Gene   UCSC   Ensembl
• Aliases: GIG3, MORT1
• Gene name: Fas associated via death domain
• Alternate names: FAS-associated death domain protein, Fas (TNFRSF6)-associated via death domain, Fas-associating death domain-containing protein, Fas-associating protein with death domain, growth-inhibiting gene 3 protein, mediator of receptor-induced toxicity,
• Gene location: 11q13.3 (70203295: 70207389)     Exons: 2     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis fact
• OMIM: 602457

Protein Summary

• Protein general information: Q13158  
  • Name: FAS associated death domain protein (FAS associating death domain containing protein) (Growth inhibiting gene 3 protein) (Mediator of receptor induced toxicity) (Protein FADD)
  • Length: 208  
  • Mass: 23279
  • Tissue specificity: Expressed in a wide variety of tissues, except for peripheral blood mononuclear leukocytes.
• Sequence:

  MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDL
  LRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN
  TEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS

• Structural information:
  • Protein Domains: (3..8-)
    (/note="DED-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00065-)
    (97..18-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR001875  IPR016729  
  • Prosite: PS50017 PS50168
  • PDB: 1A1W 1A1Z 1E3Y 1E41 2GF5 3EZQ 3OQ9 6ACI
  • PDBsum: 1A1W 1A1Z 1E3Y 1E41 2GF5 3EZQ 3OQ9 6ACI
  • DIP: 286
  • STRING: ENSP00000301838
• Other Databases: GeneCards:  FADD  Malacards:  FADD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002020	protease binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0036462	TRAIL-activated apoptotic signaling pathway	IDA	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IBA	biological process
GO:0089720	caspase binding	IBA	molecular function
GO:0036462	TRAIL-activated apoptotic signaling pathway	IBA	biological process
GO:0005123	death receptor binding	IBA	molecular function
GO:0031265	CD95 death-inducing signaling complex	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0032813	tumor necrosis factor receptor superfamily binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005123	death receptor binding	TAS	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0089720	caspase binding	IPI	molecular function
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0034138	toll-like receptor 3 signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043029	T cell homeostasis	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0060546	negative regulation of necroptotic process	IEA	biological process
GO:0070236	negative regulation of activation-induced cell death of T cells	IEA	biological process
GO:2000454	positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	IEA	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0005123	death receptor binding	IEA	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0048148	behavioral response to cocaine	IEA	biological process
GO:0060544	regulation of necroptotic process	IEA	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IEA	biological process
GO:0002821	positive regulation of adaptive immune response	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0042104	positive regulation of activated T cell proliferation	IEA	biological process
GO:0048535	lymph node development	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0097049	motor neuron apoptotic process	IEA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031264	death-inducing signaling complex	IEA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IEA	cellular component
GO:0033612	receptor serine/threonine kinase binding	IEA	molecular function
GO:0042220	response to cocaine	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0032760	positive regulation of tumor necrosis factor production	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:0097527	necroptotic signaling pathway	IMP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097342	ripoptosome	IDA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IDA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0070236	negative regulation of activation-induced cell death of T cells	ISS	biological process
GO:0043029	T cell homeostasis	ISS	biological process
GO:0035877	death effector domain binding	IPI	molecular function
GO:0035877	death effector domain binding	IPI	molecular function
GO:0097191	extrinsic apoptotic signaling pathway	TAS	biological process
GO:0048536	spleen development	ISS	biological process
GO:0031264	death-inducing signaling complex	TAS	cellular component
GO:0001916	positive regulation of T cell mediated cytotoxicity	ISS	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IMP	biological process
GO:2000454	positive regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	ISS	biological process
GO:0048538	thymus development	ISS	biological process
GO:0045651	positive regulation of macrophage differentiation	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IMP	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0048535	lymph node development	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0042104	positive regulation of activated T cell proliferation	ISS	biological process
GO:0033077	T cell differentiation in thymus	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002821	positive regulation of adaptive immune response	ISS	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05168	Herpes simplex virus 1 infection
hsa05010	Alzheimer disease
hsa05165	Human papillomavirus infection
hsa05132	Salmonella infection
hsa05163	Human cytomegalovirus infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa05152	Tuberculosis
hsa04217	Necroptosis
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa04210	Apoptosis
hsa05162	Measles
hsa04668	TNF signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa05142	Chagas disease
hsa04657	IL-17 signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa01524	Platinum drug resistance
hsa04215	Apoptosis - multiple species

Diseases

Associated diseases	References
Alzheimer's disease	PMID:16085017
leukemia	PMID:22244917
acute myeloid leukemia	PMID:15520222
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq